This list of manually curated human transcription factors is taken from Lambert, Jolma, Campitelli et al.[1]
It was assembled by manual curation.
More detailed information is found in the manuscript and the web site accompanying the paper (Human Transcription Factors)

List of human transcription factors (1639)

GeneIDDBDMotif status (Feb 2018)
(Link to human TFs annotation)
IUPAC consensus
(from selected PWM)
AC008770.3ENSG00000267179C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
AC023509.3ENSG00000267281bZIPKnown motif – from protein with 100% identical DBD – in vitro RTGACGTCAY
AC092835.1ENSG00000233757C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
AC138696.1ENSG00000264668C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro RYGGAGAGTTAGC
ADNPENSG00000101126HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
ADNP2ENSG00000101544HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
AEBP1ENSG00000106624UnknownLikely sequence specific TF according to literature or domain structure – No motif
AEBP2ENSG00000139154C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
AHCTF1ENSG00000153207AT hookLikely sequence specific TF according to literature or domain structure – No motif
AHDC1ENSG00000126705AT hookLikely sequence specific TF according to literature or domain structure – No motif
AHRENSG00000106546bHLHKnown motif – In vivo/Misc source BKNGCGTGHV
AHRRENSG00000063438bHLHInferred motif from similar protein – In vivo/Misc source BKNGCGTGHV
AIREENSG00000160224SANDKnown motif – In vivo/Misc source HNNGGWWNWDWWGGDBDH
AKAP8ENSG00000105127C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
AKAP8LENSG00000011243C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
AKNAENSG00000106948AT hookLikely sequence specific TF according to literature or domain structure – No motif
ALX1ENSG00000180318HomeodomainKnown motif – High-throughput in vitro TAATYTAATTA
ALX3ENSG00000156150HomeodomainKnown motif – High-throughput in vitro TAATTR
ALX4ENSG00000052850HomeodomainKnown motif – High-throughput in vitro TAATYNRRTTA
ANHXENSG00000227059HomeodomainKnown motif – High-throughput in vitro KTKACAWG
ANKZF1ENSG00000163516C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ARENSG00000169083Nuclear receptorKnown motif – High-throughput in vitro RGGWACRHBDYGTWCYH
ARGFXENSG00000186103HomeodomainKnown motif – High-throughput in vitro DYTAATTAR
ARHGAP35ENSG00000160007UnknownLikely sequence specific TF according to literature or domain structure – No motif
ARID2ENSG00000189079ARID/BRIGHT; RFXLikely sequence specific TF according to literature or domain structure – No motif
ARID3AENSG00000116017ARID/BRIGHTKnown motif – from protein with 100% identical DBD – in vitro DATHAAD
ARID3BENSG00000179361ARID/BRIGHTInferred motif from similar protein – High-throughput in vitro WWTTAATH
ARID3CENSG00000205143ARID/BRIGHTInferred motif from similar protein – High-throughput in vitro DATHAAD
ARID5AENSG00000196843ARID/BRIGHTKnown motif – from protein with 100% identical DBD – in vitro HAATATTD
ARID5BENSG00000150347ARID/BRIGHTKnown motif – from protein with 100% identical DBD – in vitro DATWH
ARNTENSG00000143437bHLHKnown motif – from protein with 100% identical DBD – in vitro KCACGTGM
ARNT2ENSG00000172379bHLHKnown motif – High-throughput in vitro RDCACGTGM
ARNTLENSG00000133794bHLHKnown motif – High-throughput in vitro GTCACGTGAC
ARNTL2ENSG00000029153bHLHInferred motif from similar protein – High-throughput in vitro CACGTGAY
ARXENSG00000004848HomeodomainKnown motif – High-throughput in vitro TAATYNRATTA
ASCL1ENSG00000139352bHLHKnown motif – High-throughput in vitro RCASSTGY
ASCL2ENSG00000183734bHLHKnown motif – High-throughput in vitro RCAGCTGY
ASCL3ENSG00000176009bHLHInferred motif from similar protein – High-throughput in vitro RCASSTGY
ASCL4ENSG00000187855bHLHInferred motif from similar protein – High-throughput in vitro RCASSTGY
ASCL5ENSG00000232237bHLHInferred motif from similar protein – High-throughput in vitro RCASSTGY
ASH1LENSG00000116539AT hookLikely sequence specific TF according to literature or domain structure – No motif
ATF1ENSG00000123268bZIPKnown motif – In vivo/Misc source VTGACGTSAV
ATF2ENSG00000115966bZIPKnown motif – High-throughput in vitro VTKACGTMAB
ATF3ENSG00000162772bZIPKnown motif – High-throughput in vitro RTGACGTCAY
ATF4ENSG00000128272bZIPKnown motif – High-throughput in vitro RKATGACGTCATMY
ATF5ENSG00000169136bZIPKnown motif – In vivo/Misc source WAAGGRAGARR
ATF6ENSG00000118217bZIPKnown motif – High-throughput in vitro YKRTGACGTGGCA
ATF6BENSG00000213676bZIPKnown motif – High-throughput in vitro RTGACGTGGCR
ATF7ENSG00000170653bZIPKnown motif – High-throughput in vitro DRTGACGTCAT
ATMINENSG00000166454C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ATOH1ENSG00000172238bHLHKnown motif – High-throughput in vitro RACAGCTGYY
ATOH7ENSG00000179774bHLHKnown motif – High-throughput in vitro RVCATATGBT
ATOH8ENSG00000168874bHLHInferred motif from similar protein – High-throughput in vitro AAWTANNNBRMCATATGKY
BACH1ENSG00000156273bZIPKnown motif – In vivo/Misc source RTGACTCAGCANWWH
BACH2ENSG00000112182bZIPKnown motif – High-throughput in vitro WDNSATGASTCATGNWW
BARHL1ENSG00000125492HomeodomainKnown motif – High-throughput in vitro TAAWYG
BARHL2ENSG00000143032HomeodomainKnown motif – High-throughput in vitro TAAWBG
BARX1ENSG00000131668HomeodomainKnown motif – High-throughput in vitro TAATBGNWWWTTAATBR
BARX2ENSG00000043039HomeodomainKnown motif – High-throughput in vitro TAAYKRTTWW
BATFENSG00000156127bZIPKnown motif – High-throughput in vitro VVYGMCAC
BATF2ENSG00000168062bZIPLikely sequence specific TF according to literature or domain structure – No motif
BATF3ENSG00000123685bZIPKnown motif – High-throughput in vitro VTGACGTCAYV
BAZ2AENSG00000076108MBD; AT hookLikely sequence specific TF according to literature or domain structure – No motif
BAZ2BENSG00000123636MBDLikely sequence specific TF according to literature or domain structure – No motif
BBXENSG00000114439HMG/SoxKnown motif – High-throughput in vitro TGAWCDNYGWTCA
BCL11AENSG00000119866C2H2 ZFKnown motif – In vivo/Misc source DDRRGGAASTGARAV
BCL11BENSG00000127152C2H2 ZFKnown motif – High-throughput in vitro GTGAACGBNDNNVCTACAC
BCL6ENSG00000113916C2H2 ZFKnown motif – High-throughput in vitro YGCTTTCKAGGAAH
BCL6BENSG00000161940C2H2 ZFKnown motif – High-throughput in vitro GCTTTCKAGGAAH
BHLHA15ENSG00000180535bHLHKnown motif – High-throughput in vitro VCATATGB
BHLHA9ENSG00000205899bHLHLikely sequence specific TF according to literature or domain structure – No motif
BHLHE22ENSG00000180828bHLHKnown motif – High-throughput in vitro AVCATATGBT
BHLHE23ENSG00000125533bHLHKnown motif – High-throughput in vitro AVCATATGBY
BHLHE40ENSG00000134107bHLHKnown motif – High-throughput in vitro DKCACGTGM
BHLHE41ENSG00000123095bHLHKnown motif – High-throughput in vitro RKCACGTGAY
BNC1ENSG00000169594C2H2 ZFInferred motif from similar protein – In vivo/Misc source CCRCCWTCA
BNC2ENSG00000173068C2H2 ZFInferred motif from similar protein – In vivo/Misc source CCRCCWTCA
BORCS8-MEF2BENSG00000064489MADS boxKnown motif – from protein with 100% identical DBD – in vitro CCDWWWHNRG
BPTFENSG00000171634UnknownKnown motif – In vivo/Misc source KKKNTTGTKKNV
BRF2ENSG00000104221UnknownLikely sequence specific TF according to literature or domain structure – No motif
BSXENSG00000188909HomeodomainKnown motif – High-throughput in vitro TAATBR
C11orf95ENSG00000188070BED ZFLikely sequence specific TF according to literature or domain structure – No motif
CAMTA1ENSG00000171735CG-1Likely sequence specific TF according to literature or domain structure – No motif
CAMTA2ENSG00000108509CG-1Likely sequence specific TF according to literature or domain structure – No motif
CARFENSG00000138380UnknownKnown motif – In vivo/Misc source GCCTCGTTYTSR
CASZ1ENSG00000130940C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
CBX2ENSG00000173894AT hookLikely sequence specific TF according to literature or domain structure – No motif
CC2D1AENSG00000132024UnknownLikely sequence specific TF according to literature or domain structure – No motif
CCDC169-SOHLH2ENSG00000250709bHLHKnown motif – from protein with 100% identical DBD – in vitro BCACGTGC
CCDC17ENSG00000159588C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
CDC5LENSG00000096401Myb/SANTKnown motif – In vivo/Misc source VBGWKDTAAYRWAWB
CDX1ENSG00000113722HomeodomainKnown motif – High-throughput in vitro TTTATKRB
CDX2ENSG00000165556HomeodomainKnown motif – High-throughput in vitro DWWATKRB
CDX4ENSG00000131264HomeodomainKnown motif – High-throughput in vitro VKTTTATKRCH
CEBPAENSG00000245848bZIPKnown motif – from protein with 100% identical DBD – in vitro TTGCGHAA
CEBPBENSG00000172216bZIPKnown motif – High-throughput in vitro VTTRCGCAAY
CEBPDENSG00000221869bZIPKnown motif – High-throughput in vitro VTTRCGCAAY
CEBPEENSG00000092067bZIPKnown motif – High-throughput in vitro VTTRCGCAAY
CEBPGENSG00000153879bZIPKnown motif – High-throughput in vitro RTTRCGCAAY
CEBPZENSG00000115816UnknownKnown motif – In vivo/Misc source DSTSATTGGCT
CENPAENSG00000115163UnknownLikely sequence specific TF according to literature or domain structure – No motif
CENPBENSG00000125817CENPBKnown motif – High-throughput in vitro TWCGYNNNAHRCGGG
CENPBD1ENSG00000177946CENPBKnown motif – High-throughput in vitro WNYGWAD
CENPSENSG00000175279UnknownLikely sequence specific TF according to literature or domain structure – No motif
CENPTENSG00000102901UnknownLikely sequence specific TF according to literature or domain structure – No motif
CENPXENSG00000169689UnknownLikely sequence specific TF according to literature or domain structure – No motif
CGGBP1ENSG00000163320UnknownLikely sequence specific TF according to literature or domain structure – No motif
CHAMP1ENSG00000198824C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
CHCHD3ENSG00000106554UnknownLikely sequence specific TF according to literature or domain structure – No motif
CICENSG00000079432HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro VTCAGCA
CLOCKENSG00000134852bHLHKnown motif – High-throughput in vitro DACACGTGYH
CPEB1ENSG00000214575UnknownKnown motif – High-throughput in vitro HTTTTATH
CPXCR1ENSG00000147183C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
CREB1ENSG00000118260bZIPKnown motif – High-throughput in vitro VTKACGTMA
CREB3ENSG00000107175bZIPKnown motif – High-throughput in vitro RTGACGTGKH
CREB3L1ENSG00000157613bZIPKnown motif – High-throughput in vitro TGCCACGTGGCR
CREB3L2ENSG00000182158bZIPKnown motif – from protein with 100% identical DBD – in vitro HCACGTGKM
CREB3L3ENSG00000060566bZIPLikely sequence specific TF according to literature or domain structure – No motif
CREB3L4ENSG00000143578bZIPKnown motif – High-throughput in vitro VTGACGTGGM
CREB5ENSG00000146592bZIPKnown motif – High-throughput in vitro VTKACRTMAB
CREBL2ENSG00000111269bZIPInferred motif from similar protein – High-throughput in vitro ATKACGTMAY
CREBZFENSG00000137504bZIPInferred motif from similar protein – High-throughput in vitro WWACGTWD
CREMENSG00000095794bZIPKnown motif – High-throughput in vitro VVTBACGTVAB
CRXENSG00000105392HomeodomainKnown motif – High-throughput in vitro TAATCC
CSRNP1ENSG00000144655UnknownLikely sequence specific TF according to literature or domain structure – No motif
CSRNP2ENSG00000110925UnknownLikely sequence specific TF according to literature or domain structure – No motif
CSRNP3ENSG00000178662UnknownLikely sequence specific TF according to literature or domain structure – No motif
CTCFENSG00000102974C2H2 ZFKnown motif – High-throughput in vitro CCDSBAGGKGGCGCB
CTCFLENSG00000124092C2H2 ZFKnown motif – In vivo/Misc source CCNSYAGGGGGCGCY
CUX1ENSG00000257923CUT; HomeodomainKnown motif – High-throughput in vitro ATYGATHA
CUX2ENSG00000111249CUT; HomeodomainKnown motif – High-throughput in vitro DDATYGATYA
CXXC1ENSG00000154832CxxCKnown motif – High-throughput in vitro BCG
CXXC4ENSG00000168772CxxCLikely sequence specific TF according to literature or domain structure – No motif
CXXC5ENSG00000171604CxxCKnown motif – High-throughput in vitro DCK
DACH1ENSG00000276644UnknownLikely sequence specific TF according to literature or domain structure – No motif
DACH2ENSG00000126733UnknownLikely sequence specific TF according to literature or domain structure – No motif
DBPENSG00000105516bZIPKnown motif – High-throughput in vitro RTTAYRTAAB
DBX1ENSG00000109851HomeodomainInferred motif from similar protein – High-throughput in vitro WTTAATTA
DBX2ENSG00000185610HomeodomainInferred motif from similar protein – High-throughput in vitro AH
DDIT3ENSG00000175197bZIPKnown motif – In vivo/Misc source RVVKATTGCANNB
DEAF1ENSG00000177030SANDInferred motif from similar protein – In vivo/Misc source VCRBNYYCGKGDRYTTCCGDVDNNB
DLX1ENSG00000144355HomeodomainKnown motif – High-throughput in vitro TAATTR
DLX2ENSG00000115844HomeodomainKnown motif – High-throughput in vitro TAATTR
DLX3ENSG00000064195HomeodomainKnown motif – High-throughput in vitro TAATTR
DLX4ENSG00000108813HomeodomainKnown motif – High-throughput in vitro TAATTR
DLX5ENSG00000105880HomeodomainKnown motif – High-throughput in vitro TAATTR
DLX6ENSG00000006377HomeodomainKnown motif – High-throughput in vitro TAATTR
DMBX1ENSG00000197587HomeodomainKnown motif – High-throughput in vitro HTAATCCB
DMRT1ENSG00000137090DMKnown motif – High-throughput in vitro GHWACWH
DMRT2ENSG00000173253DMKnown motif – High-throughput in vitro DATAMATT
DMRT3ENSG00000064218DMKnown motif – High-throughput in vitro DWWTTGWTACAWT
DMRTA1ENSG00000176399DMKnown motif – High-throughput in vitro DDWTGHTACAW
DMRTA2ENSG00000142700DMKnown motif – High-throughput in vitro DHBGHWACADB
DMRTB1ENSG00000143006DMLikely sequence specific TF according to literature or domain structure – No motif
DMRTC2ENSG00000142025DMKnown motif – High-throughput in vitro WWTTGHTACAW
DMTF1ENSG00000135164Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
DNMT1ENSG00000130816CxxCKnown motif – High-throughput in vitro CGG
DNTTIP1ENSG00000101457AT hookLikely sequence specific TF according to literature or domain structure – No motif
DOT1LENSG00000104885AT hookLikely sequence specific TF according to literature or domain structure – No motif
DPF1ENSG00000011332C2H2 ZFKnown motif – High-throughput in vitro KMTATAGGBG
DPF3ENSG00000205683C2H2 ZFInferred motif from similar protein – High-throughput in vitro KMTATAGGBG
DPRXENSG00000204595HomeodomainKnown motif – High-throughput in vitro RGMTAATCY
DR1ENSG00000117505UnknownLikely sequence specific TF according to literature or domain structure – No motif
DRAP1ENSG00000175550UnknownLikely sequence specific TF according to literature or domain structure – No motif
DRGXENSG00000165606HomeodomainKnown motif – High-throughput in vitro TAATYNAATTA
DUX1DUX1_HUMANHomeodomainKnown motif – In vivo/Misc source ATAATCTGATTAT
DUX3DUX3_HUMANHomeodomainKnown motif – In vivo/Misc source TTAATTAAATTAA
DUX4ENSG00000260596HomeodomainKnown motif – In vivo/Misc source TGATTRRRTTA
DUXAENSG00000258873HomeodomainKnown motif – High-throughput in vitro TGATTRVRTYD
DZIP1ENSG00000134874C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
E2F1ENSG00000101412E2FKnown motif – High-throughput in vitro WTTGGCGCCHWW
E2F2ENSG00000007968E2FKnown motif – High-throughput in vitro WDWWGGCGCCHWWH
E2F3ENSG00000112242E2FKnown motif – High-throughput in vitro TTTTGGCGCCMTTTTY
E2F4ENSG00000205250E2FKnown motif – High-throughput in vitro TTTGGCGCCAAA
E2F5ENSG00000133740E2FKnown motif – In vivo/Misc source TTTSGCGC
E2F6ENSG00000169016E2FKnown motif – In vivo/Misc source DGGMGGGARV
E2F7ENSG00000165891E2FKnown motif – High-throughput in vitro WTTTGGCGGGAAAH
E2F8ENSG00000129173E2FKnown motif – High-throughput in vitro TTTGGCGGGAAA
E4F1ENSG00000167967C2H2 ZFKnown motif – In vivo/Misc source RTGACGTARS
EBF1ENSG00000164330EBF1Known motif – High-throughput in vitro ANTCCCHWGGGAHH
EBF2ENSG00000221818EBF1Known motif – In vivo/Misc source VTGMAACCCCCWWTHVK
EBF3ENSG00000108001EBF1Known motif – In vivo/Misc source BTCCCYWGRGD
EBF4ENSG00000088881EBF1Known motif – In vivo/Misc source CGSATAACCMTTGTTATCAB
EEA1ENSG00000102189C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
EGR1ENSG00000120738C2H2 ZFKnown motif – High-throughput in vitro MCGCCCMCGCA
EGR2ENSG00000122877C2H2 ZFKnown motif – High-throughput in vitro MCGCCCACGCD
EGR3ENSG00000179388C2H2 ZFKnown motif – High-throughput in vitro HMCGCCCMCGCAH
EGR4ENSG00000135625C2H2 ZFKnown motif – High-throughput in vitro HMCGCCCACGCAH
EHFENSG00000135373EtsKnown motif – High-throughput in vitro ACCCGGAAGTD
ELF1ENSG00000120690EtsKnown motif – High-throughput in vitro WHSCGGAAGY
ELF2ENSG00000109381EtsKnown motif – High-throughput in vitro AMCCGGAAGTV
ELF3ENSG00000163435Ets; AT hookKnown motif – High-throughput in vitro WACCCGGAAGTR
ELF4ENSG00000102034EtsKnown motif – High-throughput in vitro ABSCGGAAGTR
ELF5ENSG00000135374EtsKnown motif – High-throughput in vitro WNVMGGAARY
ELK1ENSG00000126767EtsKnown motif – High-throughput in vitro RCCGGAAGT
ELK3ENSG00000111145EtsKnown motif – High-throughput in vitro RCCGGAAGT
ELK4ENSG00000158711EtsKnown motif – High-throughput in vitro ACCGGAARY
EMX1ENSG00000135638HomeodomainKnown motif – High-throughput in vitro BTAATTR
EMX2ENSG00000170370HomeodomainKnown motif – High-throughput in vitro BTAATTA
EN1ENSG00000163064HomeodomainKnown motif – High-throughput in vitro TAATTRVB
EN2ENSG00000164778HomeodomainKnown motif – High-throughput in vitro TAATTR
EOMESENSG00000163508T-boxKnown motif – High-throughput in vitro WTCACACCTH
EPAS1ENSG00000116016bHLHKnown motif – In vivo/Misc source VDACGTGHH
ERFENSG00000105722EtsKnown motif – High-throughput in vitro ACCGGAARTV
ERGENSG00000157554EtsKnown motif – High-throughput in vitro ACCGGAARY
ESR1ENSG00000091831Nuclear receptorKnown motif – High-throughput in vitro AGGTCAYSRTGACCT
ESR2ENSG00000140009Nuclear receptorKnown motif – from protein with 100% identical DBD – in vitro RGGTCAH
ESRRAENSG00000173153Nuclear receptorKnown motif – High-throughput in vitro SAAGGTCA
ESRRBENSG00000119715Nuclear receptorKnown motif – High-throughput in vitro TCAAGGTCAWH
ESRRGENSG00000196482Nuclear receptorKnown motif – High-throughput in vitro SAAGGTCR
ESX1ENSG00000123576HomeodomainKnown motif – High-throughput in vitro TAATTR
ETS1ENSG00000134954EtsKnown motif – High-throughput in vitro RCCGGAWRYRYWTCCGSH
ETS2ENSG00000157557EtsKnown motif – High-throughput in vitro ACCGGAWGYRCWTCCGGT
ETV1ENSG00000006468EtsKnown motif – High-throughput in vitro RCCGGAWRY
ETV2ENSG00000105672EtsKnown motif – High-throughput in vitro DACCGGAARYD
ETV3ENSG00000117036EtsKnown motif – High-throughput in vitro AHCGGAWWTCCGNT
ETV3LENSG00000253831EtsKnown motif – from protein with 100% identical DBD – in vitro VGGAWR
ETV4ENSG00000175832EtsKnown motif – High-throughput in vitro RCCGGAWGY
ETV5ENSG00000244405EtsKnown motif – High-throughput in vitro DVCGGAWRY
ETV6ENSG00000139083EtsKnown motif – High-throughput in vitro SCGGAASCGGAAGYR
ETV7ENSG00000010030EtsKnown motif – High-throughput in vitro VVGGAAGYRCTTCCBB
EVX1ENSG00000106038HomeodomainKnown motif – High-throughput in vitro TAATBRB
EVX2ENSG00000174279HomeodomainKnown motif – High-throughput in vitro TAATBRB
FAM170AENSG00000164334C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
FAM200BENSG00000237765BED ZFLikely sequence specific TF according to literature or domain structure – No motif
FBXL19ENSG00000099364CxxCLikely sequence specific TF according to literature or domain structure – No motif
FERD3LENSG00000146618bHLHKnown motif – High-throughput in vitro GYRMCAGCTGTBRC
FEVENSG00000163497EtsKnown motif – High-throughput in vitro ACCGGAART
FEZF1ENSG00000128610C2H2 ZFKnown motif – High-throughput in vitro AAAARRRCAV
FEZF2ENSG00000153266C2H2 ZFInferred motif from similar protein – High-throughput in vitro AAAWGAGCAATCA
FIGLAENSG00000183733bHLHKnown motif – High-throughput in vitro MCAGGTGKD
FIZ1ENSG00000179943C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
FLI1ENSG00000151702EtsKnown motif – High-throughput in vitro RCCGGAWRY
FLYWCH1ENSG00000059122FLYWCHLikely sequence specific TF according to literature or domain structure – No motif
FOSENSG00000170345bZIPKnown motif – High-throughput in vitro BRTGACGTCAYV
FOSBENSG00000125740bZIPKnown motif – High-throughput in vitro RTGACGTCAY
FOSL1ENSG00000175592bZIPKnown motif – High-throughput in vitro DRTGAYRCR
FOSL2ENSG00000075426bZIPKnown motif – High-throughput in vitro TKANTCAYNRTGACGTCAY
FOXA1ENSG00000129514ForkheadKnown motif – High-throughput in vitro BVYTAWGTAAACAAW
FOXA2ENSG00000125798ForkheadKnown motif – High-throughput in vitro HNNGTMAATATTKRYNBD
FOXA3ENSG00000170608ForkheadKnown motif – High-throughput in vitro BVYTAWGTAAACAAA
FOXB1ENSG00000171956ForkheadKnown motif – High-throughput in vitro WRWGTMAATATTKACWYW
FOXB2ENSG00000204612ForkheadInferred motif from similar protein – High-throughput in vitro HWRWGYMAATATTKRCHYW
FOXC1ENSG00000054598ForkheadKnown motif – High-throughput in vitro WRWRTMAAYAW
FOXC2ENSG00000176692ForkheadKnown motif – High-throughput in vitro WAHRTMAAYAWW
FOXD1ENSG00000251493ForkheadKnown motif – from protein with 100% identical DBD – in vitro HWASAATAAYAWW
FOXD2ENSG00000186564ForkheadKnown motif – High-throughput in vitro RTAAAYA
FOXD3ENSG00000187140ForkheadKnown motif – High-throughput in vitro RTAAAYA
FOXD4ENSG00000170122ForkheadInferred motif from similar protein – In vivo/Misc source GTTAAAGCVAKTTTAA
FOXD4L1ENSG00000184492ForkheadInferred motif from similar protein – In vivo/Misc source GTTAAAGCVAKTTTAA
FOXD4L3ENSG00000187559ForkheadInferred motif from similar protein – In vivo/Misc source MGGTAAATCMAGGGWWT
FOXD4L4ENSG00000184659ForkheadKnown motif – In vivo/Misc source MGGTAAATCMAGGGWWT
FOXD4L5ENSG00000204779ForkheadInferred motif from similar protein – In vivo/Misc source MGGTAAATCMAGGGWWT
FOXD4L6ENSG00000273514ForkheadInferred motif from similar protein – In vivo/Misc source MGGTAAATCMAGGGWWT
FOXE1ENSG00000178919ForkheadKnown motif – High-throughput in vitro BVYTAWRYAAACAD
FOXE3ENSG00000186790ForkheadInferred motif from similar protein – High-throughput in vitro BVYTAWRYAAACAD
FOXF1ENSG00000103241ForkheadKnown motif – In vivo/Misc source YRHATAAACAHNB
FOXF2ENSG00000137273ForkheadKnown motif – In vivo/Misc source BNHNBRTAAACAHNV
FOXG1ENSG00000176165ForkheadKnown motif – High-throughput in vitro RTAAACAH
FOXH1ENSG00000160973ForkheadKnown motif – In vivo/Misc source BNSAATMCACA
FOXI1ENSG00000168269ForkheadKnown motif – High-throughput in vitro RTMAACA
FOXI2ENSG00000186766ForkheadInferred motif from similar protein – High-throughput in vitro RTMAACA
FOXI3ENSG00000214336ForkheadInferred motif from similar protein – High-throughput in vitro RTMAACA
FOXJ1ENSG00000129654ForkheadKnown motif – from protein with 100% identical DBD – in vitro HAAACAAA
FOXJ2ENSG00000065970ForkheadKnown motif – High-throughput in vitro GTAAACAWMAACA
FOXJ3ENSG00000198815ForkheadKnown motif – High-throughput in vitro RTAAACAW
FOXK1ENSG00000164916ForkheadKnown motif – High-throughput in vitro RWMMAYA
FOXK2ENSG00000141568ForkheadInferred motif from similar protein – High-throughput in vitro RWMAACAA
FOXL1ENSG00000176678ForkheadKnown motif – High-throughput in vitro RTAAACA
FOXL2ENSG00000183770ForkheadKnown motif – High-throughput in vitro VBGHMAACAH
FOXM1ENSG00000111206ForkheadKnown motif – from protein with 100% identical DBD – in vitro RWHR
FOXN1ENSG00000109101ForkheadKnown motif – In vivo/Misc source WVBSACGCB
FOXN2ENSG00000170802ForkheadKnown motif – High-throughput in vitro GCGTSNNNNNSACGC
FOXN3ENSG00000053254ForkheadKnown motif – High-throughput in vitro GTAAACAA
FOXN4ENSG00000139445ForkheadKnown motif – In vivo/Misc source WHNWRRNGACGCYATNHM
FOXO1ENSG00000150907ForkheadKnown motif – High-throughput in vitro RTAAACATGTTTAC
FOXO3ENSG00000118689ForkheadKnown motif – High-throughput in vitro GTAAACAW
FOXO4ENSG00000184481ForkheadKnown motif – High-throughput in vitro GTAAACA
FOXO6ENSG00000204060ForkheadKnown motif – High-throughput in vitro GTAAACATGTTTAC
FOXP1ENSG00000114861ForkheadKnown motif – High-throughput in vitro TGTTTRYNRTNNNNNNBNAYRVWMAACA
FOXP2ENSG00000128573ForkheadKnown motif – High-throughput in vitro RTAAAYAW
FOXP3ENSG00000049768ForkheadKnown motif – High-throughput in vitro RTAAACA
FOXP4ENSG00000137166ForkheadInferred motif from similar protein – High-throughput in vitro RTMAAYA
FOXQ1ENSG00000164379ForkheadKnown motif – High-throughput in vitro YWRHRTAAACWD
FOXR1ENSG00000176302ForkheadKnown motif – High-throughput in vitro CAADY
FOXR2ENSG00000189299ForkheadKnown motif – High-throughput in vitro RYRTAWACATAAAWRHH
FOXS1ENSG00000179772ForkheadInferred motif from similar protein – High-throughput in vitro HNNRHMAAYA
GABPAENSG00000154727EtsKnown motif – High-throughput in vitro RSCGGAWRY
GATA1ENSG00000102145GATAKnown motif – High-throughput in vitro GATWASMH
GATA2ENSG00000179348GATAKnown motif – High-throughput in vitro VHGATAHSV
GATA3ENSG00000107485GATAKnown motif – High-throughput in vitro HGATAAVV
GATA4ENSG00000136574GATAKnown motif – High-throughput in vitro HGATAAVV
GATA5ENSG00000130700GATAKnown motif – High-throughput in vitro HGATAASV
GATA6ENSG00000141448GATAKnown motif – High-throughput in vitro HGATAABVATCD
GATAD2AENSG00000167491GATALikely sequence specific TF according to literature or domain structure – No motif
GATAD2BENSG00000143614GATALikely sequence specific TF according to literature or domain structure – No motif
GBX1ENSG00000164900HomeodomainKnown motif – High-throughput in vitro BTAATTRSB
GBX2ENSG00000168505HomeodomainKnown motif – High-throughput in vitro TAATTR
GCM1ENSG00000137270GCMKnown motif – High-throughput in vitro BATGCGGGTRS
GCM2ENSG00000124827GCMKnown motif – High-throughput in vitro HRCCCGCAT
GFI1ENSG00000162676C2H2 ZFKnown motif – High-throughput in vitro BMAATCACDGCNHBBCACTM
GFI1BENSG00000165702C2H2 ZFKnown motif – High-throughput in vitro MAATCASDGCNNBBCACT
GLI1ENSG00000111087C2H2 ZFKnown motif – In vivo/Misc source SMCCHCCCA
GLI2ENSG00000074047C2H2 ZFKnown motif – High-throughput in vitro GMCCACMCANVNHB
GLI3ENSG00000106571C2H2 ZFKnown motif – High-throughput in vitro VGACCACCCACVNHG
GLI4ENSG00000250571C2H2 ZFKnown motif – In vivo/Misc source RRGCCTTGAATGCCANGNYMA
GLIS1ENSG00000174332C2H2 ZFKnown motif – High-throughput in vitro MGACCCCCCACGWHG
GLIS2ENSG00000126603C2H2 ZFKnown motif – High-throughput in vitro KACCCCCCRCRDHG
GLIS3ENSG00000107249C2H2 ZFKnown motif – High-throughput in vitro KACCCCCCACRAAG
GLMPENSG00000198715UnknownLikely sequence specific TF according to literature or domain structure – No motif
GLYR1ENSG00000140632AT hookLikely sequence specific TF according to literature or domain structure – No motif
GMEB1ENSG00000162419SANDKnown motif – High-throughput in vitro KTACGTAMNKTACGTMM
GMEB2ENSG00000101216SANDKnown motif – High-throughput in vitro YBACGYAM
GPBP1ENSG00000062194UnknownLikely sequence specific TF according to literature or domain structure – No motif
GPBP1L1ENSG00000159592UnknownLikely sequence specific TF according to literature or domain structure – No motif
GRHL1ENSG00000134317GrainyheadKnown motif – High-throughput in vitro DAACCGGTTH
GRHL2ENSG00000083307GrainyheadKnown motif – In vivo/Misc source RAACHDGHHHDDCHDGTTY
GRHL3ENSG00000158055GrainyheadLikely sequence specific TF according to literature or domain structure – No motif
GSCENSG00000133937HomeodomainKnown motif – High-throughput in vitro HTAATCC
GSC2ENSG00000063515HomeodomainKnown motif – High-throughput in vitro HTAATCCBH
GSX1ENSG00000169840HomeodomainKnown motif – High-throughput in vitro TAATKR
GSX2ENSG00000180613HomeodomainKnown motif – High-throughput in vitro TAATKR
GTF2BENSG00000137947UnknownKnown motif – In vivo/Misc source STYWYAKASTS
GTF2IENSG00000263001GTF2I-likeKnown motif – In vivo/Misc source VAGVDVKTSH
GTF2IRD1ENSG00000006704GTF2I-likeKnown motif – In vivo/Misc source TRTCGCWG
GTF2IRD2ENSG00000196275GTF2I-likeLikely sequence specific TF according to literature or domain structure – No motif
GTF2IRD2BENSG00000174428GTF2I-likeLikely sequence specific TF according to literature or domain structure – No motif
GTF3AENSG00000122034C2H2 ZFKnown motif – High-throughput in vitro GGATGGGAG
GZF1ENSG00000125812C2H2 ZFKnown motif – In vivo/Misc source TATAKAVGCGCA
HAND1ENSG00000113196bHLHKnown motif – In vivo/Misc source DBRTCTGGHWDH
HAND2ENSG00000164107bHLHKnown motif – High-throughput in vitro HVCAGGTGTK
HBP1ENSG00000105856HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro DD
HDXENSG00000165259HomeodomainKnown motif – High-throughput in vitro H
HELTENSG00000187821bHLHInferred motif from similar protein – High-throughput in vitro BBCACGTGY
HES1ENSG00000114315bHLHKnown motif – High-throughput in vitro KDCRCGTGBB
HES2ENSG00000069812bHLHKnown motif – High-throughput in vitro VRCACGTGCC
HES3ENSG00000173673bHLHInferred motif from similar protein – High-throughput in vitro KDCRCGTGBB
HES4ENSG00000188290bHLHInferred motif from similar protein – High-throughput in vitro KDCRCGTGBB
HES5ENSG00000197921bHLHKnown motif – High-throughput in vitro HGGCACGTGYCR
HES6ENSG00000144485bHLHKnown motif – High-throughput in vitro DACACGTGCC
HES7ENSG00000179111bHLHKnown motif – High-throughput in vitro YGGCACGTGCCR
HESX1ENSG00000163666HomeodomainKnown motif – High-throughput in vitro HTAATTRVH
HEY1ENSG00000164683bHLHKnown motif – High-throughput in vitro BBCRCGYGY
HEY2ENSG00000135547bHLHKnown motif – High-throughput in vitro BCACGTGB
HEYLENSG00000163909bHLHInferred motif from similar protein – High-throughput in vitro BCACGTGB
HHEXENSG00000152804HomeodomainInferred motif from similar protein – High-throughput in vitro ATND
HIC1ENSG00000177374C2H2 ZFKnown motif – High-throughput in vitro RTGCCMMC
HIC2ENSG00000169635C2H2 ZFKnown motif – High-throughput in vitro BKGGCAY
HIF1AENSG00000100644bHLHKnown motif – In vivo/Misc source VVNGCACGTMBNS
HIF3AENSG00000124440bHLHInferred motif from similar protein – In vivo/Misc source RWAWWTMATAWCST
HINFPENSG00000172273C2H2 ZFKnown motif – High-throughput in vitro GCGGACGYTRSRRCGTCCGC
HIVEP1ENSG00000095951C2H2 ZFKnown motif – In vivo/Misc source KGRRRARTCCCB
HIVEP2ENSG00000010818C2H2 ZFKnown motif – In vivo/Misc source KBYDNGGHAABNSS
HIVEP3ENSG00000127124C2H2 ZFInferred motif from similar protein – In vivo/Misc source KBYDNGGHAABNSS
HKR1ENSG00000181666C2H2 ZFKnown motif – High-throughput in vitro VBKVRVNRDGGAGGRBVNVR
HLFENSG00000108924bZIPKnown motif – High-throughput in vitro VTTAYRTAAY
HLXENSG00000136630HomeodomainKnown motif – from protein with 100% identical DBD – in vitro AWND
HMBOX1ENSG00000147421HomeodomainKnown motif – High-throughput in vitro VYTAGTTAMV
HMG20AENSG00000140382HMG/SoxLikely sequence specific TF according to literature or domain structure – No motif
HMG20BENSG00000064961HMG/SoxInferred motif from similar protein – High-throughput in vitro WDWATAAT
HMGA1ENSG00000137309AT hookKnown motif – In vivo/Misc source WATTWW
HMGA2ENSG00000149948AT hookKnown motif – In vivo/Misc source ATATTSSSSDWWAWT
HMGN3ENSG00000118418HMG/SoxLikely sequence specific TF according to literature or domain structure – No motif
HMX1ENSG00000215612HomeodomainKnown motif – High-throughput in vitro TTAAKTGNY
HMX2ENSG00000188816HomeodomainKnown motif – High-throughput in vitro TTAAKTG
HMX3ENSG00000188620HomeodomainKnown motif – High-throughput in vitro TAAKTG
HNF1AENSG00000135100HomeodomainKnown motif – High-throughput in vitro GTTAATNATTAAY
HNF1BENSG00000275410HomeodomainKnown motif – High-throughput in vitro GTTAATNATTAAY
HNF4AENSG00000101076Nuclear receptorKnown motif – High-throughput in vitro VRGGTCAAAGTCCA
HNF4GENSG00000164749Nuclear receptorKnown motif – In vivo/Misc source GDNCAAAGKYCA
HOMEZENSG00000215271HomeodomainKnown motif – High-throughput in vitro WWWAATCGTTTW
HOXA1ENSG00000105991HomeodomainKnown motif – High-throughput in vitro TAATTR
HOXA10ENSG00000253293HomeodomainKnown motif – High-throughput in vitro TTWAYGAY
HOXA11ENSG00000005073HomeodomainKnown motif – High-throughput in vitro DWTTTACGACB
HOXA13ENSG00000106031HomeodomainKnown motif – High-throughput in vitro DTTTTATKRS
HOXA2ENSG00000105996HomeodomainKnown motif – High-throughput in vitro BTAATKR
HOXA3ENSG00000105997HomeodomainKnown motif – from protein with 100% identical DBD – in vitro TAATKR
HOXA4ENSG00000197576HomeodomainKnown motif – High-throughput in vitro TAATKRY
HOXA5ENSG00000106004HomeodomainKnown motif – High-throughput in vitro STAATKRS
HOXA6ENSG00000106006HomeodomainKnown motif – High-throughput in vitro TAATKRV
HOXA7ENSG00000122592HomeodomainKnown motif – High-throughput in vitro TAATKRV
HOXA9ENSG00000078399HomeodomainKnown motif – High-throughput in vitro DTTWAYGAY
HOXB1ENSG00000120094HomeodomainKnown motif – High-throughput in vitro STAATTA
HOXB13ENSG00000159184HomeodomainKnown motif – High-throughput in vitro TTWAYDD
HOXB2ENSG00000173917HomeodomainKnown motif – High-throughput in vitro TAATKR
HOXB3ENSG00000120093HomeodomainKnown motif – High-throughput in vitro BTAATKR
HOXB4ENSG00000182742HomeodomainKnown motif – High-throughput in vitro YTAATKAY
HOXB5ENSG00000120075HomeodomainKnown motif – High-throughput in vitro TAATKRV
HOXB6ENSG00000108511HomeodomainKnown motif – High-throughput in vitro TAATKRY
HOXB7ENSG00000260027HomeodomainKnown motif – High-throughput in vitro BTAATKRV
HOXB8ENSG00000120068HomeodomainKnown motif – High-throughput in vitro TAATKRM
HOXB9ENSG00000170689HomeodomainKnown motif – High-throughput in vitro WTTTAYGAY
HOXC10ENSG00000180818HomeodomainKnown motif – High-throughput in vitro WTTWAYGAB
HOXC11ENSG00000123388HomeodomainKnown motif – High-throughput in vitro WTTWAYGAYH
HOXC12ENSG00000123407HomeodomainKnown motif – High-throughput in vitro DTTTTACGAYY
HOXC13ENSG00000123364HomeodomainKnown motif – High-throughput in vitro CTCGTAAAAH
HOXC4ENSG00000198353HomeodomainKnown motif – High-throughput in vitro TAATKR
HOXC5ENSG00000172789HomeodomainKnown motif – from protein with 100% identical DBD – in vitro WRATND
HOXC6ENSG00000197757HomeodomainKnown motif – from protein with 100% identical DBD – in vitro TTAATTAB
HOXC8ENSG00000037965HomeodomainKnown motif – High-throughput in vitro YAATTR
HOXC9ENSG00000180806HomeodomainKnown motif – High-throughput in vitro TTTTACGAC
HOXD1ENSG00000128645HomeodomainKnown motif – High-throughput in vitro BTAATTAV
HOXD10ENSG00000128710HomeodomainKnown motif – High-throughput in vitro DTTTTACGACY
HOXD11ENSG00000128713HomeodomainKnown motif – High-throughput in vitro DWTTTACGAY
HOXD12ENSG00000170178HomeodomainKnown motif – High-throughput in vitro DTTTACGAY
HOXD13ENSG00000128714HomeodomainKnown motif – High-throughput in vitro BCTCGTAAAAH
HOXD3ENSG00000128652HomeodomainKnown motif – High-throughput in vitro CTAATTAS
HOXD4ENSG00000170166HomeodomainKnown motif – High-throughput in vitro TMATKRV
HOXD8ENSG00000175879HomeodomainKnown motif – High-throughput in vitro HWMATTWDB
HOXD9ENSG00000128709HomeodomainKnown motif – High-throughput in vitro TTTTATKRC
HSF1ENSG00000185122HSFKnown motif – High-throughput in vitro VGAABVTTCBVGAW
HSF2ENSG00000025156HSFKnown motif – High-throughput in vitro VGAANNTTCBVGAA
HSF4ENSG00000102878HSFKnown motif – High-throughput in vitro GAANNTTCBVGAA
HSF5ENSG00000176160HSFKnown motif – High-throughput in vitro RCGTTCTAGAAYGY
HSFX1ENSG00000171116HSFLikely sequence specific TF according to literature or domain structure – No motif
HSFX2ENSG00000268738HSFLikely sequence specific TF according to literature or domain structure – No motif
HSFY1ENSG00000172468HSFKnown motif – High-throughput in vitro DTVGAAYGWTTCGAAYGB
HSFY2ENSG00000169953HSFKnown motif – High-throughput in vitro DTCGAAHSNWTCGAW
IKZF1ENSG00000185811C2H2 ZFKnown motif – In vivo/Misc source BTGGGARD
IKZF2ENSG00000030419C2H2 ZFKnown motif – In vivo/Misc source HDWHGGGADD
IKZF3ENSG00000161405C2H2 ZFKnown motif – High-throughput in vitro VSNNGGGAA
IKZF4ENSG00000123411C2H2 ZFInferred motif from similar protein – In vivo/Misc source HDWHGGGADD
IKZF5ENSG00000095574C2H2 ZFInferred motif from similar protein – In vivo/Misc source MYYATGCAGRGT
INSM1ENSG00000173404C2H2 ZFKnown motif – In vivo/Misc source YRMCCCCWKRCA
INSM2ENSG00000168348C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
IRF1ENSG00000125347IRFKnown motif – In vivo/Misc source GAAASTGAAASY
IRF2ENSG00000168310IRFKnown motif – High-throughput in vitro GAAAVYGAAAS
IRF3ENSG00000126456IRFKnown motif – High-throughput in vitro HSGAAAVBGAAACYGAAAC
IRF4ENSG00000137265IRFKnown motif – High-throughput in vitro HCGAAACCGAAACYW
IRF5ENSG00000128604IRFKnown motif – High-throughput in vitro CGAAACCGAWACH
IRF6ENSG00000117595IRFKnown motif – High-throughput in vitro RGTWTCRNNNNNNCGAWACY
IRF7ENSG00000185507IRFKnown motif – High-throughput in vitro CGAAAVYGAAANY
IRF8ENSG00000140968IRFKnown motif – High-throughput in vitro CGAAACYGAAACY
IRF9ENSG00000213928IRFKnown motif – High-throughput in vitro AWCGAAACCGAAACY
IRX1ENSG00000170549HomeodomainKnown motif – High-throughput in vitro DDCRHNNNNNNNNDYGHH
IRX2ENSG00000170561HomeodomainKnown motif – High-throughput in vitro DTGTYRTGTH
IRX3ENSG00000177508HomeodomainKnown motif – High-throughput in vitro DACAHGNWWWWNCDTGTH
IRX4ENSG00000113430HomeodomainKnown motif – from protein with 100% identical DBD – in vitro DAMAH
IRX5ENSG00000176842HomeodomainKnown motif – High-throughput in vitro DTGTYRTGTH
IRX6ENSG00000159387HomeodomainInferred motif from similar protein – High-throughput in vitro DAMAH
ISL1ENSG00000016082HomeodomainKnown motif – High-throughput in vitro BTAAKTGS
ISL2ENSG00000159556HomeodomainKnown motif – High-throughput in vitro YTAAKTGB
ISXENSG00000175329HomeodomainKnown motif – High-throughput in vitro CYAATTAV
JAZF1ENSG00000153814C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
JDP2ENSG00000140044bZIPKnown motif – High-throughput in vitro RTKACRTMAY
JRKENSG00000234616CENPBLikely sequence specific TF according to literature or domain structure – No motif
JRKLENSG00000183340CENPBInferred motif from similar protein – High-throughput in vitro RCGGWWR
JUNENSG00000177606bZIPKnown motif – High-throughput in vitro DATGACGTMAHNV
JUNBENSG00000171223bZIPKnown motif – High-throughput in vitro RTKACGTMAY
JUNDENSG00000130522bZIPKnown motif – High-throughput in vitro VTGACGTMA
KAT7ENSG00000136504C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
KCMF1ENSG00000176407C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
KCNIP3ENSG00000115041UnknownLikely sequence specific TF according to literature or domain structure – No motif
KDM2AENSG00000173120CxxCLikely sequence specific TF according to literature or domain structure – No motif
KDM2BENSG00000089094CxxCKnown motif – High-throughput in vitro CG
KDM5BENSG00000117139ARID/BRIGHTLikely sequence specific TF according to literature or domain structure – No motif
KINENSG00000151657C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
KLF1ENSG00000105610C2H2 ZFKnown motif – High-throughput in vitro CMCGCCCM
KLF10ENSG00000155090C2H2 ZFKnown motif – High-throughput in vitro RMCACRCCCMYVHCACRCCCMC
KLF11ENSG00000172059C2H2 ZFKnown motif – High-throughput in vitro VMCMCRCCCMYNMCACGCCCMC
KLF12ENSG00000118922C2H2 ZFKnown motif – High-throughput in vitro DRCCACGCCCH
KLF13ENSG00000169926C2H2 ZFKnown motif – High-throughput in vitro RCCACRCCCMC
KLF14ENSG00000266265C2H2 ZFKnown motif – High-throughput in vitro DRHCACGCCCMYYH
KLF15ENSG00000163884C2H2 ZFKnown motif – High-throughput in vitro VHCMCVCCCMY
KLF16ENSG00000129911C2H2 ZFKnown motif – High-throughput in vitro VMCMCDCCCMC
KLF17ENSG00000171872C2H2 ZFKnown motif – High-throughput in vitro MMCCACVCWCCCMTY
KLF2ENSG00000127528C2H2 ZFKnown motif – High-throughput in vitro VCCMCRCCCH
KLF3ENSG00000109787C2H2 ZFKnown motif – High-throughput in vitro RRCCRCGCCCH
KLF4ENSG00000136826C2H2 ZFKnown motif – High-throughput in vitro VCCACRCCCH
KLF5ENSG00000102554C2H2 ZFKnown motif – High-throughput in vitro MCACRCCCH
KLF6ENSG00000067082C2H2 ZFKnown motif – High-throughput in vitro VMCACRCCCH
KLF7ENSG00000118263C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro HHMCRCCCH
KLF8ENSG00000102349C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro MCRCCY
KLF9ENSG00000119138C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro TAACGG
KMT2AENSG00000118058CxxC; AT hookKnown motif – High-throughput in vitro HNCGNB
KMT2BENSG00000272333CxxC; AT hookLikely sequence specific TF according to literature or domain structure – No motif
L3MBTL1ENSG00000185513C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
L3MBTL3ENSG00000198945C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
L3MBTL4ENSG00000154655C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
LBX1ENSG00000138136HomeodomainKnown motif – High-throughput in vitro TAAYTRG
LBX2ENSG00000179528HomeodomainKnown motif – High-throughput in vitro TAATTRV
LCORENSG00000196233PipsqueakKnown motif – from protein with 100% identical DBD – in vitro YNAAW
LCORLENSG00000178177PipsqueakKnown motif – High-throughput in vitro HYNAAWH
LEF1ENSG00000138795HMG/SoxKnown motif – High-throughput in vitro SATCAAAS
LEUTXENSG00000213921HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
LHX1ENSG00000273706HomeodomainKnown motif – High-throughput in vitro TRATBR
LHX2ENSG00000106689HomeodomainKnown motif – High-throughput in vitro HHDTTR
LHX3ENSG00000107187HomeodomainKnown motif – from protein with 100% identical DBD – in vitro YAATHW
LHX4ENSG00000121454HomeodomainKnown motif – High-throughput in vitro BYRATTRV
LHX5ENSG00000089116HomeodomainKnown motif – High-throughput in vitro TAATTRS
LHX6ENSG00000106852HomeodomainKnown motif – High-throughput in vitro TRATTR
LHX8ENSG00000162624HomeodomainKnown motif – High-throughput in vitro STAATTA
LHX9ENSG00000143355HomeodomainKnown motif – High-throughput in vitro TAATTRG
LIN28AENSG00000131914CSDInferred motif from similar protein – High-throughput in vitro CGCHGYYHYWYCGCG
LIN28BENSG00000187772CSDKnown motif – High-throughput in vitro CGCHGYYHYWYCGCG
LIN54ENSG00000189308TCR/CxCInferred motif from similar protein – High-throughput in vitro RTTYAAAH
LMX1AENSG00000162761HomeodomainKnown motif – High-throughput in vitro BTAATTA
LMX1BENSG00000136944HomeodomainKnown motif – High-throughput in vitro TWATTR
LTFENSG00000012223UnknownKnown motif – In vivo/Misc source GKVACTKB
LYL1ENSG00000104903bHLHInferred motif from similar protein – In vivo/Misc source RNCAGVTGGH
MAFENSG00000178573bZIPKnown motif – High-throughput in vitro TGCTGACDHDRCR
MAFAENSG00000182759bZIPKnown motif – High-throughput in vitro WWWNTGCTGACD
MAFBENSG00000204103bZIPKnown motif – from protein with 100% identical DBD – in vitro TGCTGAC
MAFFENSG00000185022bZIPKnown motif – High-throughput in vitro YGCTGASTCAGCR
MAFGENSG00000197063bZIPKnown motif – High-throughput in vitro YGCTGABNDNGCR
MAFKENSG00000198517bZIPKnown motif – High-throughput in vitro DNNYGCTKAVTCAGCRNNH
MAXENSG00000125952bHLHKnown motif – High-throughput in vitro CACGTG
MAZENSG00000103495C2H2 ZFKnown motif – High-throughput in vitro GGGMGGGGS
MBD1ENSG00000141644MBD; CxxC ZFLikely sequence specific TF according to literature or domain structure – No motif
MBD2ENSG00000134046MBDKnown motif – In vivo/Misc source VSGKCCGGMKR
MBD3ENSG00000071655MBDLikely sequence specific TF according to literature or domain structure – No motif
MBD4ENSG00000129071MBDLikely sequence specific TF according to literature or domain structure – No motif
MBD6ENSG00000166987MBDLikely sequence specific TF according to literature or domain structure – No motif
MBNL2ENSG00000139793CCCH ZFLikely sequence specific TF according to literature or domain structure – High-throughput in vitro YGCYTYGCYTH
MECOMENSG00000085276C2H2 ZFKnown motif – In vivo/Misc source WGAYAAGATAANAND
MECP2ENSG00000169057MBD; AT hookKnown motif – from protein with 100% identical DBD – in vitro DTD
MEF2AENSG00000068305MADS boxKnown motif – High-throughput in vitro KCTAWAAATAGM
MEF2BENSG00000213999MADS boxKnown motif – High-throughput in vitro TGTTACCATAWHBGG
MEF2CENSG00000081189MADS boxKnown motif – High-throughput in vitro TWCTAWAAATAG
MEF2DENSG00000116604MADS boxKnown motif – High-throughput in vitro DCTAWAAATAGM
MEIS1ENSG00000143995HomeodomainKnown motif – High-throughput in vitro TGACA
MEIS2ENSG00000134138HomeodomainKnown motif – High-throughput in vitro TGACASSTGTC
MEIS3ENSG00000105419HomeodomainKnown motif – High-throughput in vitro TGACAGSTGTCA
MEOX1ENSG00000005102HomeodomainKnown motif – High-throughput in vitro STAATTA
MEOX2ENSG00000106511HomeodomainKnown motif – High-throughput in vitro STMATYA
MESP1ENSG00000166823bHLHKnown motif – High-throughput in vitro HVCACCTGB
MESP2ENSG00000188095bHLHKnown motif – High-throughput in vitro AMCATATGKYR
MGAENSG00000174197T-boxKnown motif – High-throughput in vitro AGGTGTKAHDTMACACCT
MITFENSG00000187098bHLHKnown motif – from protein with 100% identical DBD – in vitro RTCACGHG
MIXL1ENSG00000185155HomeodomainKnown motif – High-throughput in vitro TAATTR
MKXENSG00000150051HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
MLXENSG00000108788bHLHKnown motif – High-throughput in vitro VCACGTGVY
MLXIPENSG00000175727bHLHInferred motif from similar protein – High-throughput in vitro HCACGTGV
MLXIPLENSG00000009950bHLHKnown motif – High-throughput in vitro DDCACGTGNH
MNTENSG00000070444bHLHKnown motif – High-throughput in vitro DNCACGTGB
MNX1ENSG00000130675HomeodomainKnown motif – High-throughput in vitro HTAATTRNH
MSANTD1ENSG00000188981MADFLikely sequence specific TF according to literature or domain structure – No motif
MSANTD3ENSG00000066697MADFKnown motif – High-throughput in vitro SBNCACTCAM
MSANTD4ENSG00000170903Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
MSCENSG00000178860bHLHKnown motif – High-throughput in vitro RMCAGCTGBYV
MSGN1ENSG00000151379bHLHKnown motif – High-throughput in vitro VMCAWWTGGY
MSX1ENSG00000163132HomeodomainKnown motif – High-throughput in vitro TAATTR
MSX2ENSG00000120149HomeodomainKnown motif – High-throughput in vitro TAATTGB
MTERF1ENSG00000127989mTERFKnown motif – In vivo/Misc source TGGTAVWRKTYGGT
MTERF2ENSG00000120832mTERFLikely sequence specific TF according to literature or domain structure – No motif
MTERF3ENSG00000156469mTERFLikely sequence specific TF according to literature or domain structure – No motif
MTERF4ENSG00000122085mTERFLikely sequence specific TF according to literature or domain structure – No motif
MTF1ENSG00000188786C2H2 ZFKnown motif – High-throughput in vitro TTTGCACACGGCAC
MTF2ENSG00000143033UnknownKnown motif – High-throughput in vitro
MXD1ENSG00000059728bHLHInferred motif from similar protein – In vivo/Misc source CACGTGAY
MXD3ENSG00000213347bHLHInferred motif from similar protein – In vivo/Misc source CACGTGAY
MXD4ENSG00000123933bHLHInferred motif from similar protein – In vivo/Misc source CACGTGAY
MXI1ENSG00000119950bHLHKnown motif – In vivo/Misc source CCACGTGG
MYBENSG00000118513Myb/SANTKnown motif – In vivo/Misc source BAACKGNH
MYBL1ENSG00000185697Myb/SANTKnown motif – High-throughput in vitro HRACCGTTW
MYBL2ENSG00000101057Myb/SANTKnown motif – High-throughput in vitro WAACGGTY
MYCENSG00000136997bHLHKnown motif – In vivo/Misc source RCCACGTGSB
MYCLENSG00000116990bHLHInferred motif from similar protein – In vivo/Misc source RCCACGTG
MYCNENSG00000134323bHLHKnown motif – High-throughput in vitro VCACGTG
MYF5ENSG00000111049bHLHKnown motif – In vivo/Misc source VCWSCASSTGYCW
MYF6ENSG00000111046bHLHKnown motif – High-throughput in vitro RACASSTGWYV
MYNNENSG00000085274C2H2 ZFKnown motif – High-throughput in vitro AAAWTAARAGYC
MYOD1ENSG00000129152bHLHKnown motif – High-throughput in vitro YGHCAGSTGKYV
MYOGENSG00000122180bHLHKnown motif – High-throughput in vitro RACARCTGWCR
MYPOPENSG00000176182Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
MYRFENSG00000124920Ndt80/PhoGKnown motif – High-throughput in vitro TGGTACCA
MYRFLENSG00000166268Ndt80/PhoGLikely sequence specific TF according to literature or domain structure – No motif
MYSM1ENSG00000162601Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
MYT1ENSG00000196132C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
MYT1LENSG00000186487C2H2 ZFInferred motif from similar protein – High-throughput in vitro VAAGTTT
MZF1ENSG00000099326C2H2 ZFKnown motif – In vivo/Misc source DRDGGGGAD
NACC2ENSG00000148411UnknownLikely sequence specific TF according to literature or domain structure – No motif
NAIF1ENSG00000171169MADFInferred motif from similar protein – High-throughput in vitro TACGYH
NANOGENSG00000111704HomeodomainKnown motif – High-throughput in vitro YRABBVB
NANOGNBENSG00000205857HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
NANOGP8ENSG00000255192HomeodomainKnown motif – from protein with 100% identical DBD – in vitro YRABBVB
NCOA1ENSG00000084676bHLHLikely sequence specific TF according to literature or domain structure – No motif
NCOA2ENSG00000140396bHLHLikely sequence specific TF according to literature or domain structure – No motif
NCOA3ENSG00000124151bHLHLikely sequence specific TF according to literature or domain structure – No motif
NEUROD1ENSG00000162992bHLHKnown motif – High-throughput in vitro AAWTANNNBRMCATATGKY
NEUROD2ENSG00000171532bHLHKnown motif – High-throughput in vitro RMCATATGBY
NEUROD4ENSG00000123307bHLHInferred motif from similar protein – High-throughput in vitro AAWTANNNBRMCATATGKY
NEUROD6ENSG00000164600bHLHInferred motif from similar protein – High-throughput in vitro AAWTANNNBRMCATATGKY
NEUROG1ENSG00000181965bHLHKnown motif – High-throughput in vitro RVCATATGBY
NEUROG2ENSG00000178403bHLHKnown motif – High-throughput in vitro RVCATATGBY
NEUROG3ENSG00000122859bHLHInferred motif from similar protein – High-throughput in vitro RVCATATGBY
NFAT5ENSG00000102908RelKnown motif – High-throughput in vitro RTGGAAAWKTACH
NFATC1ENSG00000131196RelKnown motif – High-throughput in vitro RTGGAAAHW
NFATC2ENSG00000101096RelKnown motif – High-throughput in vitro DYGGAAANW
NFATC3ENSG00000072736RelKnown motif – High-throughput in vitro YGGAAANH
NFATC4ENSG00000100968RelKnown motif – High-throughput in vitro YRBWWW
NFE2ENSG00000123405bZIPKnown motif – High-throughput in vitro VATGACTCATB
NFE2L1ENSG00000082641bZIPKnown motif – In vivo/Misc source ATGAYD
NFE2L2ENSG00000116044bZIPKnown motif – In vivo/Misc source VVTGACTMAGCA
NFE2L3ENSG00000050344bZIPKnown motif – In vivo/Misc source TATTWSCAAGGA
NFE4ENSG00000230257UnknownKnown motif – In vivo/Misc source VHCCCKMKCCWS
NFIAENSG00000162599SMADKnown motif – High-throughput in vitro YTGGCANNNTGCCAA
NFIBENSG00000147862SMADKnown motif – High-throughput in vitro TTGGCANNNTGCCAR
NFICENSG00000141905SMADKnown motif – High-throughput in vitro YTGGCANNNNGCCAA
NFIL3ENSG00000165030bZIPKnown motif – High-throughput in vitro VTTACRTAAY
NFIXENSG00000008441SMADKnown motif – High-throughput in vitro TTGGCANNNTGCCAR
NFKB1ENSG00000109320RelKnown motif – High-throughput in vitro AGGGGAWTCCCCK
NFKB2ENSG00000077150RelKnown motif – High-throughput in vitro VGGGGAWTCCCC
NFX1ENSG00000086102NFXLikely sequence specific TF according to literature or domain structure – No motif
NFXL1ENSG00000170448NFXLikely sequence specific TF according to literature or domain structure – No motif
NFYAENSG00000001167CBF/NF-YKnown motif – In vivo/Misc source HBSYSATTGGYYV
NFYBENSG00000120837UnknownKnown motif – In vivo/Misc source CTSATTGGYYVVNNB
NFYCENSG00000066136UnknownKnown motif – In vivo/Misc source BSTSATTGGYYR
NHLH1ENSG00000171786bHLHKnown motif – High-throughput in vitro DKGRCGCAGCTGMKNCH
NHLH2ENSG00000177551bHLHKnown motif – High-throughput in vitro DDGNMGCAGCTGCGYCMH
NKRFENSG00000186416UnknownLikely sequence specific TF according to literature or domain structure – No motif
NKX1-1ENSG00000235608HomeodomainKnown motif – from protein with 100% identical DBD – in vitro TAATND
NKX1-2ENSG00000229544HomeodomainKnown motif – from protein with 100% identical DBD – in vitro TAAWND
NKX2-1ENSG00000136352HomeodomainKnown motif – from protein with 100% identical DBD – in vitro RAGDR
NKX2-2ENSG00000125820HomeodomainKnown motif – from protein with 100% identical DBD – in vitro RAGDR
NKX2-3ENSG00000119919HomeodomainKnown motif – High-throughput in vitro VCACTTV
NKX2-4ENSG00000125816HomeodomainKnown motif – from protein with 100% identical DBD – in vitro RAGDR
NKX2-5ENSG00000183072HomeodomainKnown motif – High-throughput in vitro VCACTTRDV
NKX2-6ENSG00000180053HomeodomainInferred motif from similar protein – High-throughput in vitro HYAAGTRB
NKX2-8ENSG00000136327HomeodomainKnown motif – High-throughput in vitro BTSRAGTGB
NKX3-1ENSG00000167034HomeodomainKnown motif – High-throughput in vitro TAAGTGS
NKX3-2ENSG00000109705HomeodomainKnown motif – High-throughput in vitro TAAGTGS
NKX6-1ENSG00000163623HomeodomainKnown motif – from protein with 100% identical DBD – in vitro DTDATNR
NKX6-2ENSG00000148826HomeodomainKnown motif – High-throughput in vitro DTAATTR
NKX6-3ENSG00000165066HomeodomainKnown motif – High-throughput in vitro WTAATGRB
NME2ENSG00000243678UnknownLikely sequence specific TF according to literature or domain structure – No motif
NOBOXENSG00000106410HomeodomainKnown motif – High-throughput in vitro HDATDR
NOTOENSG00000214513HomeodomainKnown motif – High-throughput in vitro YWMATTA
NPAS1ENSG00000130751bHLHInferred motif from similar protein – In vivo/Misc source VVNGCACGTMBNS
NPAS2ENSG00000170485bHLHKnown motif – High-throughput in vitro DMCACGTGY
NPAS3ENSG00000151322bHLHInferred motif from similar protein – In vivo/Misc source VVNGCACGTMBNS
NPAS4ENSG00000174576bHLHInferred motif from similar protein – High-throughput in vitro
NR0B1ENSG00000169297UnknownKnown motif – In vivo/Misc source YBTYCCMCKS
NR1D1ENSG00000126368Nuclear receptorKnown motif – High-throughput in vitro TGACCYASTRACCYANWW
NR1D2ENSG00000174738Nuclear receptorKnown motif – High-throughput in vitro YRACMYANTRACMYMNWWH
NR1H2ENSG00000131408Nuclear receptorKnown motif – In vivo/Misc source TAAAGGTCAAAGGTCAASK
NR1H3ENSG00000025434Nuclear receptorInferred motif from similar protein – In vivo/Misc source TAAAGGTCAAAGGTCAASK
NR1H4ENSG00000012504Nuclear receptorKnown motif – High-throughput in vitro RGKTCRTTGACCYBNNRGGTBADRGKKBNDRGKTCAHHKD
NR1I2ENSG00000144852Nuclear receptorKnown motif – High-throughput in vitro YGMMCYBNNYGMMCY
NR1I3ENSG00000143257Nuclear receptorKnown motif – High-throughput in vitro RGKDYRNNNNRGKKYR
NR2C1ENSG00000120798Nuclear receptorKnown motif – High-throughput in vitro RGKKCRYGAMMY
NR2C2ENSG00000177463Nuclear receptorKnown motif – High-throughput in vitro VRGGTCAAAGGTCA
NR2E1ENSG00000112333Nuclear receptorKnown motif – High-throughput in vitro AAGTCA
NR2E3ENSG00000278570Nuclear receptorKnown motif – High-throughput in vitro RAGATCAM
NR2F1ENSG00000175745Nuclear receptorKnown motif – High-throughput in vitro RRGGTCAAAGGTCA
NR2F2ENSG00000185551Nuclear receptorKnown motif – from protein with 100% identical DBD – in vitro RRGGTCA
NR2F6ENSG00000160113Nuclear receptorKnown motif – High-throughput in vitro RGGTCAAAGGTCA
NR3C1ENSG00000113580Nuclear receptorKnown motif – High-throughput in vitro RGWACAYNRTGTWCYH
NR3C2ENSG00000151623Nuclear receptorKnown motif – High-throughput in vitro RGDACAHDRTGTHCY
NR4A1ENSG00000123358Nuclear receptorKnown motif – High-throughput in vitro AAAGGTCA
NR4A2ENSG00000153234Nuclear receptorKnown motif – High-throughput in vitro BTAAAGGTCA
NR4A3ENSG00000119508Nuclear receptorKnown motif – In vivo/Misc source CAAAGGTCAS
NR5A1ENSG00000136931Nuclear receptorKnown motif – High-throughput in vitro CAAGGYCR
NR5A2ENSG00000116833Nuclear receptorKnown motif – High-throughput in vitro YCAAGGTCAH
NR6A1ENSG00000148200Nuclear receptorKnown motif – High-throughput in vitro SAAGKTCAAGKKYR
NRF1ENSG00000106459UnknownKnown motif – High-throughput in vitro YRCGCATGCGC
NRLENSG00000129535bZIPKnown motif – High-throughput in vitro DWHNYGCTGAC
OLIG1ENSG00000184221bHLHKnown motif – High-throughput in vitro AVCATATGKT
OLIG2ENSG00000205927bHLHKnown motif – High-throughput in vitro AMCATATGKY
OLIG3ENSG00000177468bHLHKnown motif – High-throughput in vitro RSCATATGKY
ONECUT1ENSG00000169856CUT; HomeodomainKnown motif – High-throughput in vitro DDTATCGATYD
ONECUT2ENSG00000119547CUT; HomeodomainKnown motif – High-throughput in vitro DTATCGATCS
ONECUT3ENSG00000205922CUT; HomeodomainKnown motif – High-throughput in vitro DWTATYGATTTTY
OSR1ENSG00000143867C2H2 ZFKnown motif – High-throughput in vitro HACRGTAGC
OSR2ENSG00000164920C2H2 ZFKnown motif – High-throughput in vitro HVCRGTAGC
OTPENSG00000171540HomeodomainKnown motif – from protein with 100% identical DBD – in vitro HAATND
OTX1ENSG00000115507HomeodomainKnown motif – High-throughput in vitro TAATCSB
OTX2ENSG00000165588HomeodomainKnown motif – High-throughput in vitro HTAATCCB
OVOL1ENSG00000172818C2H2 ZFKnown motif – High-throughput in vitro RNRTAACGGTHH
OVOL2ENSG00000125850C2H2 ZFKnown motif – High-throughput in vitro DNNTARCGGD
OVOL3ENSG00000105261C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PA2G4ENSG00000170515UnknownLikely sequence specific TF according to literature or domain structure – No motif
PATZ1ENSG00000100105C2H2 ZF; AT hookKnown motif – In vivo/Misc source GGGHGGGG
PAX1ENSG00000125813Paired boxKnown motif – High-throughput in vitro SGTCACGCWTSANTGVH
PAX2ENSG00000075891Homeodomain; Paired boxKnown motif – High-throughput in vitro SGTCACGCWTSRNTGVNY
PAX3ENSG00000135903Homeodomain; Paired boxKnown motif – High-throughput in vitro TAATCRATTA
PAX4ENSG00000106331Homeodomain; Paired boxKnown motif – High-throughput in vitro HKAATTAR
PAX5ENSG00000196092Paired boxKnown motif – High-throughput in vitro GTYACGSWTSRNTRVNY
PAX6ENSG00000007372Homeodomain; Paired boxKnown motif – High-throughput in vitro YACGCHYSRNYRMNY
PAX7ENSG00000009709Homeodomain; Paired boxKnown motif – High-throughput in vitro TAATYRATTW
PAX8ENSG00000125618Paired boxKnown motif – High-throughput in vitro RNBYRNYSRWGCGTGACS
PAX9ENSG00000198807Paired boxKnown motif – High-throughput in vitro SGTCACGCWTSANTGM
PBX1ENSG00000185630HomeodomainKnown motif – High-throughput in vitro TGATKGAYR
PBX2ENSG00000204304HomeodomainKnown motif – In vivo/Misc source KRVHKTGATTGAWK
PBX3ENSG00000167081HomeodomainKnown motif – In vivo/Misc source BBBTGATTGRYND
PBX4ENSG00000105717HomeodomainKnown motif – High-throughput in vitro HDWHH
PCGF2ENSG00000277258UnknownLikely sequence specific TF according to literature or domain structure – No motif
PCGF6ENSG00000156374UnknownLikely sequence specific TF according to literature or domain structure – No motif
PDX1ENSG00000139515HomeodomainKnown motif – High-throughput in vitro BTAATKR
PEG3ENSG00000198300C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PGRENSG00000082175Nuclear receptorKnown motif – High-throughput in vitro RGNACRNNNTGTNCH
PHF1ENSG00000112511UnknownKnown motif – High-throughput in vitro
PHF19ENSG00000119403UnknownLikely sequence specific TF according to literature or domain structure – No motif
PHF20ENSG00000025293AT hookLikely sequence specific TF according to literature or domain structure – No motif
PHF21AENSG00000135365AT hookLikely sequence specific TF according to literature or domain structure – No motif
PHOX2AENSG00000165462HomeodomainKnown motif – High-throughput in vitro TAATTRVRTTA
PHOX2BENSG00000109132HomeodomainKnown motif – High-throughput in vitro TAATTRVRTTA
PIN1ENSG00000127445MBDLikely sequence specific TF according to literature or domain structure – No motif
PITX1ENSG00000069011HomeodomainKnown motif – High-throughput in vitro HTAATCC
PITX2ENSG00000164093HomeodomainKnown motif – High-throughput in vitro TAAKCC
PITX3ENSG00000107859HomeodomainKnown motif – High-throughput in vitro HTAATCC
PKNOX1ENSG00000160199HomeodomainKnown motif – High-throughput in vitro TGACAGCTGTCA
PKNOX2ENSG00000165495HomeodomainKnown motif – High-throughput in vitro TGACAGSTGTCA
PLAG1ENSG00000181690C2H2 ZFKnown motif – High-throughput in vitro GGGGCCHWMGGGGG
PLAGL1ENSG00000118495C2H2 ZFKnown motif – In vivo/Misc source RGGCCCCCYB
PLAGL2ENSG00000126003C2H2 ZFKnown motif – High-throughput in vitro RGGGGCCC
PLSCR1ENSG00000188313UnknownLikely sequence specific TF according to literature or domain structure – No motif
POGKENSG00000143157BrinkerLikely sequence specific TF according to literature or domain structure – No motif
POU1F1ENSG00000064835Homeodomain; POUKnown motif – High-throughput in vitro DWTATGCWAATKAD
POU2AF1ENSG00000110777UnknownKnown motif – In vivo/Misc source GATKTGCAKAT
POU2F1ENSG00000143190Homeodomain; POUKnown motif – High-throughput in vitro WTGMATATKYADD
POU2F2ENSG00000028277Homeodomain; POUKnown motif – High-throughput in vitro DTGMATATKYADD
POU2F3ENSG00000137709Homeodomain; POUKnown motif – High-throughput in vitro TATGYWAAT
POU3F1ENSG00000185668Homeodomain; POUKnown motif – High-throughput in vitro WTATGYWAATD
POU3F2ENSG00000184486Homeodomain; POUKnown motif – High-throughput in vitro WTATGYWAATKW
POU3F3ENSG00000198914Homeodomain; POUKnown motif – High-throughput in vitro WWDMWTAWKHAW
POU3F4ENSG00000196767Homeodomain; POUKnown motif – High-throughput in vitro WDAWTTATKCA
POU4F1ENSG00000152192Homeodomain; POUKnown motif – High-throughput in vitro TDMATWATKYA
POU4F2ENSG00000151615Homeodomain; POUKnown motif – High-throughput in vitro BTMATTAAWTATKCA
POU4F3ENSG00000091010Homeodomain; POUKnown motif – High-throughput in vitro RTNMATWATKYAT
POU5F1ENSG00000204531Homeodomain; POUKnown motif – High-throughput in vitro WTATGYWAATKWVB
POU5F1BENSG00000212993Homeodomain; POUKnown motif – High-throughput in vitro TATGYWAAT
POU5F2ENSG00000248483Homeodomain; POULikely sequence specific TF according to literature or domain structure – No motif
POU6F1ENSG00000184271Homeodomain; POUKnown motif – High-throughput in vitro MTCATTAH
POU6F2ENSG00000106536Homeodomain; POUKnown motif – High-throughput in vitro DTAATKAGBH
PPARAENSG00000186951Nuclear receptorKnown motif – In vivo/Misc source DAGGTCA
PPARDENSG00000112033Nuclear receptorKnown motif – High-throughput in vitro RRGGTCAAAGGTCA
PPARGENSG00000132170Nuclear receptorKnown motif – from protein with 100% identical DBD – in vitro VNTRMCCYANWDNRACCTWTNVCCYVNW
PRDM1ENSG00000057657C2H2 ZFKnown motif – High-throughput in vitro RAAAGTGAAAGTD
PRDM10ENSG00000170325C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PRDM12ENSG00000130711C2H2 ZFKnown motif – In vivo/Misc source GACAGNTKACC
PRDM13ENSG00000112238C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PRDM14ENSG00000147596C2H2 ZFKnown motif – In vivo/Misc source RSTTAGRGACCY
PRDM15ENSG00000141956C2H2 ZFKnown motif – In vivo/Misc source DTGGAAHTCCMA
PRDM16ENSG00000142611C2H2 ZFInferred motif from similar protein – In vivo/Misc source DAGAYAAGATAANM
PRDM2ENSG00000116731C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PRDM4ENSG00000110851C2H2 ZFKnown motif – High-throughput in vitro TTTCAAGGCCCCC
PRDM5ENSG00000138738C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PRDM6ENSG00000061455C2H2 ZFKnown motif – In vivo/Misc source RVARDRRAAADDVWRRAAAA
PRDM8ENSG00000152784C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PRDM9ENSG00000164256C2H2 ZFKnown motif – High-throughput in vitro VGNGGBNRSGGDGGNNNNARVRRV
PREBENSG00000138073UnknownLikely sequence specific TF according to literature or domain structure – No motif
PRMT3ENSG00000185238C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
PROP1ENSG00000175325HomeodomainKnown motif – High-throughput in vitro TAAYYNMATTA
PROX1ENSG00000117707ProsperoKnown motif – High-throughput in vitro BAAGACGYCTTV
PROX2ENSG00000119608ProsperoInferred motif from similar protein – High-throughput in vitro BAMGRCGTCDTV
PRR12ENSG00000126464AT hookLikely sequence specific TF according to literature or domain structure – No motif
PRRX1ENSG00000116132HomeodomainKnown motif – High-throughput in vitro TAATTR
PRRX2ENSG00000167157HomeodomainKnown motif – High-throughput in vitro TAATTRV
PTF1AENSG00000168267bHLHKnown motif – High-throughput in vitro VYGTCAGCTGTT
PURAENSG00000185129UnknownKnown motif – In vivo/Misc source CYMBGSCHNCMMMBWCC
PURBENSG00000146676UnknownLikely sequence specific TF according to literature or domain structure – No motif
PURGENSG00000172733UnknownLikely sequence specific TF according to literature or domain structure – No motif
RAG1ENSG00000166349UnknownLikely sequence specific TF according to literature or domain structure – No motif
RARAENSG00000131759Nuclear receptorKnown motif – High-throughput in vitro RRGGTCANV
RARBENSG00000077092Nuclear receptorKnown motif – High-throughput in vitro TGACCYYTTGACCYY
RARGENSG00000172819Nuclear receptorKnown motif – High-throughput in vitro VGGTCA
RAXENSG00000134438HomeodomainKnown motif – High-throughput in vitro HTAATTR
RAX2ENSG00000173976HomeodomainKnown motif – High-throughput in vitro TAATTR
RBAKENSG00000146587C2H2 ZFKnown motif – High-throughput in vitro VGDRASRARVRRSV
RBCK1ENSG00000125826UnknownLikely sequence specific TF according to literature or domain structure – No motif
RBPJENSG00000168214CSLKnown motif – High-throughput in vitro BTCHCA
RBPJLENSG00000124232CSLInferred motif from similar protein – In vivo/Misc source DTTCCCABR
RBSNENSG00000131381C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
RELENSG00000162924RelKnown motif – In vivo/Misc source GGAAWNYCCV
RELAENSG00000173039RelKnown motif – In vivo/Misc source BKGGAAAKYCCCH
RELBENSG00000104856RelKnown motif – In vivo/Misc source DKSAAAKYCCCB
REPIN1ENSG00000214022C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
RESTENSG00000084093C2H2 ZFKnown motif – In vivo/Misc source DTCAGSACCWYGGACAGCDSC
REXO4ENSG00000148300UnknownLikely sequence specific TF according to literature or domain structure – No motif
RFX1ENSG00000132005RFXKnown motif – High-throughput in vitro BGTTRYCATGRYAACV
RFX2ENSG00000087903RFXKnown motif – High-throughput in vitro BGTTRCCATGGYAACV
RFX3ENSG00000080298RFXKnown motif – High-throughput in vitro BGTTDCCATGGYAAC
RFX4ENSG00000111783RFXKnown motif – High-throughput in vitro GTWRYCATRGHWAC
RFX5ENSG00000143390RFXKnown motif – High-throughput in vitro BGTTGCYATGGYAACV
RFX6ENSG00000185002RFXInferred motif from similar protein – High-throughput in vitro GTHDYYNNS
RFX7ENSG00000181827RFXKnown motif – High-throughput in vitro BGTTRCYRY
RFX8ENSG00000196460RFXLikely sequence specific TF according to literature or domain structure – No motif
RHOXF1ENSG00000101883HomeodomainKnown motif – High-throughput in vitro TRAKCCH
RHOXF2ENSG00000131721HomeodomainKnown motif – High-throughput in vitro TAATCC
RHOXF2BENSG00000203989HomeodomainInferred motif from similar protein – High-throughput in vitro TAATCC
RLFENSG00000117000C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
RORAENSG00000069667Nuclear receptorKnown motif – High-throughput in vitro MRAGGTCAAVYYVAGGTCA
RORBENSG00000198963Nuclear receptorKnown motif – High-throughput in vitro AWNBRGGTCA
RORCENSG00000143365Nuclear receptorKnown motif – High-throughput in vitro TGMCCYANWTH
RREB1ENSG00000124782C2H2 ZFKnown motif – In vivo/Misc source MCMCMAMMCAMCMMCHMMSV
RUNX1ENSG00000159216RuntKnown motif – In vivo/Misc source VACCACAV
RUNX2ENSG00000124813RuntKnown motif – High-throughput in vitro HRACCRCADWAACCRCAV
RUNX3ENSG00000020633RuntKnown motif – High-throughput in vitro WAACCRCAR
RXRAENSG00000186350Nuclear receptorKnown motif – High-throughput in vitro RRGGTCAAAGGTCA
RXRBENSG00000204231Nuclear receptorKnown motif – High-throughput in vitro RRGGTCAAAGGTCA
RXRGENSG00000143171Nuclear receptorKnown motif – High-throughput in vitro RRGGTCAAAGGTCA
SAFBENSG00000160633UnknownLikely sequence specific TF according to literature or domain structure – No motif
SAFB2ENSG00000130254UnknownLikely sequence specific TF according to literature or domain structure – No motif
SALL1ENSG00000103449C2H2 ZFInferred motif from similar protein – In vivo/Misc source RYYCAAAAB
SALL2ENSG00000165821C2H2 ZFKnown motif – In vivo/Misc source CCCACCC
SALL3ENSG00000256463C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
SALL4ENSG00000101115C2H2 ZFInferred motif from similar protein – In vivo/Misc source GCTGATAACAGV
SATB1ENSG00000182568CUT; HomeodomainKnown motif – In vivo/Misc source WKWWWTAAHGRYMNWW
SATB2ENSG00000119042CUT; HomeodomainInferred motif from similar protein – In vivo/Misc source WKWWWTAAHGRYMNWW
SCMH1ENSG00000010803UnknownLikely sequence specific TF according to literature or domain structure – No motif
SCML4ENSG00000146285AT hookLikely sequence specific TF according to literature or domain structure – No motif
SCRT1ENSG00000261678C2H2 ZFKnown motif – High-throughput in vitro KCAACAGGTD
SCRT2ENSG00000215397C2H2 ZFKnown motif – High-throughput in vitro RHGCAACAGGTGB
SCXENSG00000260428bHLHInferred motif from similar protein – High-throughput in vitro VCRKMYGB
SEBOXENSG00000274529HomeodomainInferred motif from similar protein – High-throughput in vitro HTTAATTA
SETBP1ENSG00000152217AT hookLikely sequence specific TF according to literature or domain structure – No motif
SETDB1ENSG00000143379MBDKnown motif – In vivo/Misc source RACTHCMDYTCCCRKVRDGCHNYG
SETDB2ENSG00000136169MBDLikely sequence specific TF according to literature or domain structure – No motif
SGSM2ENSG00000141258BED ZFLikely sequence specific TF according to literature or domain structure – No motif
SHOXENSG00000185960HomeodomainKnown motif – High-throughput in vitro TAATTR
SHOX2ENSG00000168779HomeodomainKnown motif – High-throughput in vitro BTAATTR
SIM1ENSG00000112246bHLHInferred motif from similar protein – In vivo/Misc source VVNGCACGTMBNS
SIM2ENSG00000159263bHLHInferred motif from similar protein – In vivo/Misc source VVNGCACGTMBNS
SIX1ENSG00000126778HomeodomainKnown motif – High-throughput in vitro VBGTATCR
SIX2ENSG00000170577HomeodomainKnown motif – High-throughput in vitro VSGTATCR
SIX3ENSG00000138083HomeodomainKnown motif – High-throughput in vitro VVTATCR
SIX4ENSG00000100625HomeodomainKnown motif – High-throughput in vitro VBGTATCRB
SIX5ENSG00000177045HomeodomainKnown motif – In vivo/Misc source GGAGTTGT
SIX6ENSG00000184302HomeodomainKnown motif – High-throughput in vitro VBSTATCR
SKIENSG00000157933UnknownLikely sequence specific TF according to literature or domain structure – No motif
SKILENSG00000136603UnknownLikely sequence specific TF according to literature or domain structure – No motif
SKOR1ENSG00000188779UnknownKnown motif – High-throughput in vitro WNVKGTAATTAMB
SKOR2ENSG00000215474SANDKnown motif – High-throughput in vitro WNVKGTAATTAA
SLC2A4RGENSG00000125520C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
SMAD1ENSG00000170365SMADKnown motif – In vivo/Misc source DRCAGASAGGSH
SMAD3ENSG00000166949SMADKnown motif – High-throughput in vitro YGTCTAGACA
SMAD4ENSG00000141646SMADKnown motif – from protein with 100% identical DBD – in vitro KCYAGACR
SMAD5ENSG00000113658SMADKnown motif – High-throughput in vitro YGTCTAGACW
SMAD9ENSG00000120693SMADKnown motif – In vivo/Misc source WGGTCTAGMCMT
SMYD3ENSG00000185420UnknownLikely sequence specific TF according to literature or domain structure – No motif
SNAI1ENSG00000124216C2H2 ZFKnown motif – High-throughput in vitro VCACCTGY
SNAI2ENSG00000019549C2H2 ZFKnown motif – High-throughput in vitro RRCAGGTGYR
SNAI3ENSG00000185669C2H2 ZFKnown motif – High-throughput in vitro DRCAGGTGYR
SNAPC2ENSG00000104976UnknownLikely sequence specific TF according to literature or domain structure – No motif
SNAPC4ENSG00000165684Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
SNAPC5ENSG00000174446UnknownLikely sequence specific TF according to literature or domain structure – No motif
SOHLH1ENSG00000165643bHLHLikely sequence specific TF according to literature or domain structure – No motif
SOHLH2ENSG00000120669bHLHKnown motif – High-throughput in vitro BCACGTGC
SONENSG00000159140UnknownLikely sequence specific TF according to literature or domain structure – No motif
SOX1ENSG00000182968HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro WBAAW
SOX10ENSG00000100146HMG/SoxKnown motif – High-throughput in vitro DAACAWWGVV
SOX11ENSG00000176887HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro VACAAW
SOX12ENSG00000177732HMG/SoxKnown motif – High-throughput in vitro MCCGAACAAT
SOX13ENSG00000143842HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro RAACAATW
SOX14ENSG00000168875HMG/SoxKnown motif – High-throughput in vitro WCAATR
SOX15ENSG00000129194HMG/SoxKnown motif – High-throughput in vitro ATCAATAMCATTGAT
SOX17ENSG00000164736HMG/SoxKnown motif – High-throughput in vitro DRACAATRV
SOX18ENSG00000203883HMG/SoxKnown motif – High-throughput in vitro ATCAATGHWATTGAT
SOX2ENSG00000181449HMG/SoxKnown motif – High-throughput in vitro HATCAATANCATTGATH
SOX21ENSG00000125285HMG/SoxKnown motif – High-throughput in vitro TCAMTRHCATTGA
SOX3ENSG00000134595HMG/SoxKnown motif – High-throughput in vitro SBNAMAATRB
SOX30ENSG00000039600HMG/SoxKnown motif – High-throughput in vitro RACAAT
SOX4ENSG00000124766HMG/SoxKnown motif – High-throughput in vitro AACAAWGR
SOX5ENSG00000134532HMG/SoxKnown motif – High-throughput in vitro DVACAATRV
SOX6ENSG00000110693HMG/SoxKnown motif – High-throughput in vitro DRACAATRV
SOX7ENSG00000171056HMG/SoxKnown motif – High-throughput in vitro DAACAATKDYAKTGTT
SOX8ENSG00000005513HMG/SoxKnown motif – High-throughput in vitro HATCAATTKCAGTGAT
SOX9ENSG00000125398HMG/SoxKnown motif – High-throughput in vitro DDACAATRV
SP1ENSG00000185591C2H2 ZFKnown motif – High-throughput in vitro RCCMCDCCCMH
SP100ENSG00000067066SANDLikely sequence specific TF according to literature or domain structure – No motif
SP110ENSG00000135899SANDLikely sequence specific TF according to literature or domain structure – No motif
SP140ENSG00000079263SANDLikely sequence specific TF according to literature or domain structure – No motif
SP140LENSG00000185404SANDLikely sequence specific TF according to literature or domain structure – No motif
SP2ENSG00000167182C2H2 ZFKnown motif – High-throughput in vitro YWAGYCCCGCCCMCYH
SP3ENSG00000172845C2H2 ZFKnown motif – High-throughput in vitro VCCMCRCCCMY
SP4ENSG00000105866C2H2 ZFKnown motif – High-throughput in vitro WRGCCACGCCCMCHY
SP5ENSG00000204335C2H2 ZFKnown motif – In vivo/Misc source ACCVCGCCKCCSS
SP6ENSG00000189120C2H2 ZFInferred motif from similar protein – High-throughput in vitro HNGCCACGCCCARK
SP7ENSG00000170374C2H2 ZFKnown motif – In vivo/Misc source VBNSGGGGNGG
SP8ENSG00000164651C2H2 ZFKnown motif – High-throughput in vitro VMCACBCCCMCH
SP9ENSG00000217236C2H2 ZFKnown motif – High-throughput in vitro VMCMCGCCCMYH
SPDEFENSG00000124664EtsKnown motif – High-throughput in vitro AMCCGGATRTD
SPENENSG00000065526UnknownLikely sequence specific TF according to literature or domain structure – No motif
SPI1ENSG00000066336EtsKnown motif – High-throughput in vitro RAAAAGMGGAAGTW
SPIBENSG00000269404EtsKnown motif – High-throughput in vitro WWWRVGGAAST
SPICENSG00000166211EtsKnown motif – High-throughput in vitro RAAWSVGGAAGTM
SPZ1ENSG00000164299UnknownKnown motif – In vivo/Misc source GGSDGWWMCVBHBG
SRCAPENSG00000080603AT hookLikely sequence specific TF according to literature or domain structure – No motif
SREBF1ENSG00000072310bHLHKnown motif – High-throughput in vitro VHCACVCSAY
SREBF2ENSG00000198911bHLHKnown motif – High-throughput in vitro RTCACGTGAY
SRFENSG00000112658MADS boxKnown motif – High-throughput in vitro DCCWTATATGGT
SRYENSG00000184895HMG/SoxKnown motif – High-throughput in vitro AACAATGNTATTGTT
ST18ENSG00000147488C2H2 ZFInferred motif from similar protein – High-throughput in vitro VAAGTTT
STAT1ENSG00000115415STATKnown motif – In vivo/Misc source HTTCCYRGAAR
STAT2ENSG00000170581STATKnown motif – In vivo/Misc source TNRGTTTCDNTTYC
STAT3ENSG00000168610STATKnown motif – In vivo/Misc source HTTCCYRKMA
STAT4ENSG00000138378STATKnown motif – In vivo/Misc source BDHTTCTBGKAAD
STAT5AENSG00000126561STATKnown motif – In vivo/Misc source YTTCYNRGAAHY
STAT5BENSG00000173757STATKnown motif – In vivo/Misc source ADTTCYHRGAAA
STAT6ENSG00000166888STATKnown motif – In vivo/Misc source DWTTYCNDDGAA
TENSG00000164458T-boxKnown motif – High-throughput in vitro ANGTGYGAHWWNTVRCACCT
TAL1ENSG00000162367bHLHKnown motif – In vivo/Misc source RNCAGVTGGH
TAL2ENSG00000186051bHLHInferred motif from similar protein – In vivo/Misc source RNCAGVTGGH
TBPENSG00000112592TBPKnown motif – from protein with 100% identical DBD – in vitro WWWWAW
TBPL1ENSG00000028839TBPLikely sequence specific TF according to literature or domain structure – No motif
TBPL2ENSG00000182521TBPInferred motif from similar protein – High-throughput in vitro WWWWAW
TBR1ENSG00000136535T-boxKnown motif – High-throughput in vitro TTCACACCT
TBX1ENSG00000184058T-boxKnown motif – High-throughput in vitro TCACACCT
TBX10ENSG00000167800T-boxInferred motif from similar protein – High-throughput in vitro BYTCACACCYHV
TBX15ENSG00000092607T-boxKnown motif – High-throughput in vitro TCACACCT
TBX18ENSG00000112837T-boxKnown motif – High-throughput in vitro BYTCACACCTHH
TBX19ENSG00000143178T-boxKnown motif – High-throughput in vitro TMRCACNTABGTGYBAH
TBX2ENSG00000121068T-boxKnown motif – High-throughput in vitro VRCRC
TBX20ENSG00000164532T-boxKnown motif – High-throughput in vitro TCACRCBYTMACACCT
TBX21ENSG00000073861T-boxKnown motif – High-throughput in vitro WTCACACCTH
TBX22ENSG00000122145T-boxKnown motif – In vivo/Misc source AGGTGWSAAWTTCACACCT
TBX3ENSG00000135111T-boxKnown motif – High-throughput in vitro YVACACSH
TBX4ENSG00000121075T-boxKnown motif – High-throughput in vitro TVACACCT
TBX5ENSG00000089225T-boxKnown motif – High-throughput in vitro TVACACCT
TBX6ENSG00000149922T-boxKnown motif – High-throughput in vitro TVACACSY
TCF12ENSG00000140262bHLHKnown motif – High-throughput in vitro VCACSTGB
TCF15ENSG00000125878bHLHInferred motif from similar protein – High-throughput in vitro VCRKMYGB
TCF20ENSG00000100207UnknownLikely sequence specific TF according to literature or domain structure – No motif
TCF21ENSG00000118526bHLHKnown motif – High-throughput in vitro RVCAGCTGTTV
TCF23ENSG00000163792bHLHInferred motif from similar protein – High-throughput in vitro VCRKMYGB
TCF24ENSG00000261787bHLHInferred motif from similar protein – High-throughput in vitro RMCAKMTGK
TCF3ENSG00000071564bHLHKnown motif – High-throughput in vitro VCAGGTGB
TCF4ENSG00000196628bHLHKnown motif – High-throughput in vitro HRCACCTGB
TCF7ENSG00000081059HMG/SoxKnown motif – High-throughput in vitro DSATCAAWS
TCF7L1ENSG00000152284HMG/SoxKnown motif – High-throughput in vitro AAAGATCAAAGG
TCF7L2ENSG00000148737HMG/SoxKnown motif – from protein with 100% identical DBD – in vitro SWTCAAAV
TCFL5ENSG00000101190bHLHKnown motif – High-throughput in vitro KCRCGCGCHC
TEAD1ENSG00000187079TEAKnown motif – High-throughput in vitro RCATTCCDH
TEAD2ENSG00000074219TEAKnown motif – High-throughput in vitro YRCATTCCW
TEAD3ENSG00000007866TEAKnown motif – High-throughput in vitro RCATTCYDNDCATWCCD
TEAD4ENSG00000197905TEAKnown motif – High-throughput in vitro RMATTCYD
TEFENSG00000167074bZIPKnown motif – High-throughput in vitro VTTACRTAAB
TERB1ENSG00000249961Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
TERF1ENSG00000147601Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
TERF2ENSG00000132604Myb/SANTInferred motif from similar protein – High-throughput in vitro AACCCTAV
TET1ENSG00000138336CxxCKnown motif – High-throughput in vitro HVCGH
TET2ENSG00000168769UnknownLikely sequence specific TF according to literature or domain structure – No motif
TET3ENSG00000187605CxxCLikely sequence specific TF according to literature or domain structure – No motif
TFAP2AENSG00000137203AP-2Known motif – High-throughput in vitro HSCCYBVRGGCD
TFAP2BENSG00000008196AP-2Known motif – High-throughput in vitro SCCBNVGGS
TFAP2CENSG00000087510AP-2Known motif – High-throughput in vitro HGCCYBVRGGSD
TFAP2DENSG00000008197AP-2Known motif – In vivo/Misc source RCGNGCCBCRGVCB
TFAP2EENSG00000116819AP-2Known motif – High-throughput in vitro HSCCYSRGGSD
TFAP4ENSG00000090447bHLHKnown motif – High-throughput in vitro VWCAGCTGWB
TFCP2ENSG00000135457GrainyheadKnown motif – High-throughput in vitro WCCGGWWHDAWCYGGW
TFCP2L1ENSG00000115112GrainyheadKnown motif – High-throughput in vitro DCYRGHNNNDDCYRGH
TFDP1ENSG00000198176E2FKnown motif – In vivo/Misc source DYYTCSCGCYMWWY
TFDP2ENSG00000114126E2FInferred motif from similar protein – In vivo/Misc source DYYTCSCGCYMWWY
TFDP3ENSG00000183434E2FInferred motif from similar protein – In vivo/Misc source DYYTCSCGCYMWWY
TFE3ENSG00000068323bHLHKnown motif – High-throughput in vitro RKCACGTGNB
TFEBENSG00000112561bHLHKnown motif – High-throughput in vitro RNCACGTGAY
TFECENSG00000105967bHLHKnown motif – High-throughput in vitro RNCACRTGAB
TGIF1ENSG00000177426HomeodomainKnown motif – High-throughput in vitro TGACAGCTGTCA
TGIF2ENSG00000118707HomeodomainKnown motif – High-throughput in vitro TGACABVTGTCA
TGIF2LXENSG00000153779HomeodomainKnown motif – High-throughput in vitro TGACASSTGTCA
TGIF2LYENSG00000176679HomeodomainKnown motif – High-throughput in vitro TGACABVTGTCA
THAP1ENSG00000131931THAP fingerKnown motif – In vivo/Misc source BYYGCCMKNANYMAAVATGGCSV
THAP10ENSG00000129028THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP11ENSG00000168286THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP12ENSG00000137492THAP fingerKnown motif – High-throughput in vitro YMBNNBGR
THAP2ENSG00000173451THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP3ENSG00000041988THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP4ENSG00000176946THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP5ENSG00000177683THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP6ENSG00000174796THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP7ENSG00000184436THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP8ENSG00000161277THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THAP9ENSG00000168152THAP fingerLikely sequence specific TF according to literature or domain structure – No motif
THRAENSG00000126351Nuclear receptorKnown motif – High-throughput in vitro DTGACCTBATRAGGTCAH
THRBENSG00000151090Nuclear receptorKnown motif – High-throughput in vitro TGWCCTBRNYVAGGWCA
THYN1ENSG00000151500UnknownLikely sequence specific TF according to literature or domain structure – No motif
TIGD1ENSG00000221944CENPBKnown motif – High-throughput in vitro SCGCAATA
TIGD2ENSG00000180346CENPBInferred motif from similar protein – High-throughput in vitro RCGGWWR
TIGD3ENSG00000173825CENPBLikely sequence specific TF according to literature or domain structure – No motif
TIGD4ENSG00000169989CENPBLikely sequence specific TF according to literature or domain structure – No motif
TIGD5ENSG00000179886CENPBLikely sequence specific TF according to literature or domain structure – No motif
TIGD6ENSG00000164296CENPBInferred motif from similar protein – High-throughput in vitro WVCRWA
TIGD7ENSG00000140993CENPBLikely sequence specific TF according to literature or domain structure – No motif
TLX1ENSG00000107807HomeodomainKnown motif – In vivo/Misc source VCHHVTTRVCV
TLX2ENSG00000115297HomeodomainKnown motif – High-throughput in vitro BTAATTR
TLX3ENSG00000164438HomeodomainKnown motif – High-throughput in vitro AATKGNNNNNNNNNNNNNCAATT
TMF1ENSG00000144747UnknownLikely sequence specific TF according to literature or domain structure – No motif
TOPORSENSG00000197579UnknownKnown motif – In vivo/Misc source TCCCAGCTACTTTGGGA
TP53ENSG00000141510p53Known motif – In vivo/Misc source DRCATGYYBRGRCATGYCY
TP63ENSG00000073282p53Known motif – High-throughput in vitro DACATGTYVYRACATGTY
TP73ENSG00000078900p53Known motif – In vivo/Misc source DRRCAWGYHCWGRCWTGYH
TPRX1ENSG00000178928HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
TRAFD1ENSG00000135148C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
TRERF1ENSG00000124496C2H2 ZF; Myb/SANTInferred motif from similar protein – In vivo/Misc source AGACKTTAGTCA
TRPS1ENSG00000104447GATAKnown motif – In vivo/Misc source HWSRARATAGWDDMH
TSC22D1ENSG00000102804UnknownLikely sequence specific TF according to literature or domain structure – No motif
TSHZ1ENSG00000179981C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
TSHZ2ENSG00000182463C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
TSHZ3ENSG00000121297C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
TTF1ENSG00000125482Myb/SANTLikely sequence specific TF according to literature or domain structure – No motif
TWIST1ENSG00000122691bHLHKnown motif – In vivo/Misc source MHVCACHTGSD
TWIST2ENSG00000233608bHLHKnown motif – from protein with 100% identical DBD – in vitro MCATATGT
UBP1ENSG00000153560GrainyheadKnown motif – High-throughput in vitro DCYRGHNNNNDCYRGH
UNCXENSG00000164853HomeodomainKnown motif – High-throughput in vitro TAATTR
USF1ENSG00000158773bHLHKnown motif – High-throughput in vitro RNCACGTGRY
USF2ENSG00000105698bHLHKnown motif – High-throughput in vitro VCACGTGVC
USF3ENSG00000176542bHLHLikely sequence specific TF according to literature or domain structure – No motif
VAX1ENSG00000148704HomeodomainKnown motif – High-throughput in vitro YTAATKA
VAX2ENSG00000116035HomeodomainKnown motif – High-throughput in vitro YTAATKA
VDRENSG00000111424Nuclear receptorKnown motif – High-throughput in vitro TGAACYCDRTGAACYC
VENTXENSG00000151650HomeodomainKnown motif – High-throughput in vitro VNTAATBR
VEZF1ENSG00000136451C2H2 ZFKnown motif – High-throughput in vitro RKGGGGGG
VSX1ENSG00000100987HomeodomainKnown motif – High-throughput in vitro TAATTRS
VSX2ENSG00000119614HomeodomainKnown motif – High-throughput in vitro YTAATTA
WIZENSG00000011451C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
WT1ENSG00000184937C2H2 ZFKnown motif – High-throughput in vitro BGGGGGRG
XBP1ENSG00000100219bZIPKnown motif – High-throughput in vitro GVTGACGTGKCVHW
XPAENSG00000136936UnknownKnown motif – High-throughput in vitro VCACCTCACMY
YBX1ENSG00000065978CSDKnown motif – High-throughput in vitro YGTWCCAYC
YBX2ENSG00000006047CSDInferred motif from similar protein – High-throughput in vitro YGTWCCAYC
YBX3ENSG00000060138CSDKnown motif – from protein with 100% identical DBD – in vitro YGTWCCAYC
YY1ENSG00000100811C2H2 ZFKnown motif – High-throughput in vitro HRWNATGGCB
YY2ENSG00000230797C2H2 ZFKnown motif – High-throughput in vitro DDNATGGCGG
ZBED1ENSG00000214717BED ZFKnown motif – High-throughput in vitro YATGTCGCGAYAD
ZBED2ENSG00000177494BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBED3ENSG00000132846BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBED4ENSG00000100426BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBED5ENSG00000236287BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBED6ENSG00000257315BED ZFInferred motif from similar protein – In vivo/Misc source VVRGCGAGCYYV
ZBED9ENSG00000232040BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB1ENSG00000126804C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro HMMCGCRH
ZBTB10ENSG00000205189C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB11ENSG00000066422C2H2 ZFKnown motif – In vivo/Misc source GGGGKGCRCMCA
ZBTB12ENSG00000204366C2H2 ZFKnown motif – High-throughput in vitro CTAGAACMB
ZBTB14ENSG00000198081C2H2 ZFKnown motif – High-throughput in vitro VDCGTGCACGCGCRH
ZBTB16ENSG00000109906C2H2 ZFKnown motif – In vivo/Misc source BTVNWYBKVHKBTAAADYWKKRHYWRDKY
ZBTB17ENSG00000116809C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB18ENSG00000179456C2H2 ZFKnown motif – High-throughput in vitro DKCCAGATGTK
ZBTB2ENSG00000181472C2H2 ZFKnown motif – High-throughput in vitro DKWACCGGRA
ZBTB20ENSG00000181722C2H2 ZFKnown motif – High-throughput in vitro VYATACRTYV
ZBTB21ENSG00000173276C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB22ENSG00000236104C2H2 ZFKnown motif – High-throughput in vitro HKCACWAYNRTWGTGMD
ZBTB24ENSG00000112365C2H2 ZF; AT hookLikely sequence specific TF according to literature or domain structure – No motif
ZBTB25ENSG00000089775C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB26ENSG00000171448C2H2 ZFKnown motif – High-throughput in vitro DHTCYAGAAHR
ZBTB3ENSG00000185670C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro DSCAGYK
ZBTB32ENSG00000011590C2H2 ZFKnown motif – High-throughput in vitro HGTACAGTRWYACTGTACD
ZBTB33ENSG00000177485C2H2 ZFKnown motif – In vivo/Misc source SVNTCTCGCGAGANB
ZBTB34ENSG00000177125C2H2 ZFInferred motif from similar protein – High-throughput in vitro DTCGGCYAABDCGGCA
ZBTB37ENSG00000185278C2H2 ZFKnown motif – High-throughput in vitro DTCGGCYAABDCGGCA
ZBTB38ENSG00000177311C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB39ENSG00000166860C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB4ENSG00000174282C2H2 ZFKnown motif – In vivo/Misc source CVCHAHCRCYMTBG
ZBTB40ENSG00000184677C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB41ENSG00000177888C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB42ENSG00000179627C2H2 ZFKnown motif – High-throughput in vitro MRCAKCTGS
ZBTB43ENSG00000169155C2H2 ZFKnown motif – High-throughput in vitro GTGCTRNNNNNDDGGCAC
ZBTB44ENSG00000196323C2H2 ZFKnown motif – High-throughput in vitro RMTGCAKB
ZBTB45ENSG00000119574C2H2 ZFKnown motif – High-throughput in vitro BMTATAGGBR
ZBTB46ENSG00000130584C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB47ENSG00000114853C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB48ENSG00000204859C2H2 ZFKnown motif – In vivo/Misc source YHAGGGANHDD
ZBTB49ENSG00000168826C2H2 ZFKnown motif – High-throughput in vitro TGACVBGYCARGCRRAA
ZBTB5ENSG00000168795C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB6ENSG00000186130C2H2 ZFKnown motif – In vivo/Misc source VGRTGMTRGAGCC
ZBTB7AENSG00000178951C2H2 ZFKnown motif – High-throughput in vitro RCGACCACCNV
ZBTB7BENSG00000160685C2H2 ZFKnown motif – High-throughput in vitro DCGACCMCCVA
ZBTB7CENSG00000184828C2H2 ZFKnown motif – High-throughput in vitro DCRACCACCVH
ZBTB8AENSG00000160062C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB8BENSG00000273274C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZBTB9ENSG00000213588C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZC3H8ENSG00000144161CCCH ZFLikely sequence specific TF according to literature or domain structure – No motif
ZEB1ENSG00000148516C2H2 ZF; HomeodomainKnown motif – In vivo/Misc source CAGGTGNR
ZEB2ENSG00000169554C2H2 ZF; HomeodomainInferred motif from similar protein – In vivo/Misc source CAGGTGNR
ZFATENSG00000066827C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFHX2ENSG00000136367HomeodomainKnown motif – High-throughput in vitro TRATYA
ZFHX3ENSG00000140836C2H2 ZF; HomeodomainKnown motif – High-throughput in vitro RMTND
ZFHX4ENSG00000091656C2H2 ZF; HomeodomainInferred motif from similar protein – In vivo/Misc source WAATWAWTAAY
ZFP1ENSG00000184517C2H2 ZFKnown motif – High-throughput in vitro TDYBATACCCANHH
ZFP14ENSG00000142065C2H2 ZFKnown motif – High-throughput in vitro GGAGSHHHHDGARHK
ZFP2ENSG00000198939C2H2 ZFInferred motif from similar protein – In vivo/Misc source RGRAAVYGAAACT
ZFP28ENSG00000196867C2H2 ZFKnown motif – High-throughput in vitro AYMNHWRARGAAAHDGARMKVHHDNDNNDNNH
ZFP3ENSG00000180787C2H2 ZFKnown motif – High-throughput in vitro GGNTGNRTAGGAGYTYDB
ZFP30ENSG00000120784C2H2 ZFInferred motif from similar protein – High-throughput in vitro RAHRNRGYTRNRDRNRG
ZFP37ENSG00000136866C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFP41ENSG00000181638C2H2 ZFKnown motif – High-throughput in vitro RYGGAGAGTTAGC
ZFP42ENSG00000179059C2H2 ZFKnown motif – High-throughput in vitro CAAKATGGCBGHC
ZFP57ENSG00000204644C2H2 ZFKnown motif – In vivo/Misc source SNNVNNVBTGCCGCV
ZFP62ENSG00000196670C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFP64ENSG00000020256C2H2 ZFKnown motif – In vivo/Misc source VGGRSCCCGGGVVNS
ZFP69ENSG00000187815C2H2 ZFKnown motif – High-throughput in vitro GWGRCTRGAWAC
ZFP69BENSG00000187801C2H2 ZFKnown motif – High-throughput in vitro GTGGCTGGARVV
ZFP82ENSG00000181007C2H2 ZFKnown motif – High-throughput in vitro AGAATTAGTRAAYTGGAARAY
ZFP90ENSG00000184939C2H2 ZFKnown motif – High-throughput in vitro RYACTGCTTTWG
ZFP91ENSG00000186660C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFP92ENSG00000189420C2H2 ZFKnown motif – In vivo/Misc source MGATAAAAKGM
ZFPM1ENSG00000179588C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFPM2ENSG00000169946C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZFXENSG00000005889C2H2 ZFKnown motif – In vivo/Misc source VVSVSBNBBAGGCCBVGSH
ZFYENSG00000067646C2H2 ZFInferred motif from similar protein – In vivo/Misc source BAGGCCBVGSYBVV
ZGLP1ENSG00000220201GATALikely sequence specific TF according to literature or domain structure – No motif
ZGPATENSG00000197114CCCH ZFLikely sequence specific TF according to literature or domain structure – No motif
ZHX1ENSG00000165156HomeodomainKnown motif – High-throughput in vitro DYB
ZHX2ENSG00000178764HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
ZHX3ENSG00000174306HomeodomainLikely sequence specific TF according to literature or domain structure – No motif
ZIC1ENSG00000152977C2H2 ZFKnown motif – High-throughput in vitro DCRCAGCRGGGGGBV
ZIC2ENSG00000043355C2H2 ZFKnown motif – from protein with 100% identical DBD – in vitro YNRBRKG
ZIC3ENSG00000156925C2H2 ZFKnown motif – High-throughput in vitro KCACAGCRGGGGGTCB
ZIC4ENSG00000174963C2H2 ZFKnown motif – High-throughput in vitro DCNCHRCRGGGGGYM
ZIC5ENSG00000139800C2H2 ZFKnown motif – High-throughput in vitro DCDCAGCGGGGGGTM
ZIK1ENSG00000171649C2H2 ZFKnown motif – High-throughput in vitro RDRRCAAWRGCAMNRVRWNNB
ZIM2ENSG00000269699C2H2 ZFKnown motif – In vivo/Misc source YCNBSYBSCYTYYYCHBCCVGCCYGKGGYY
ZIM3ENSG00000141946C2H2 ZFKnown motif – High-throughput in vitro RNHAACAGAAANCYM
ZKSCAN1ENSG00000106261C2H2 ZFKnown motif – High-throughput in vitro CCTACTAHGH
ZKSCAN2ENSG00000155592C2H2 ZFKnown motif – High-throughput in vitro RRRRRMMAC
ZKSCAN3ENSG00000189298C2H2 ZFKnown motif – High-throughput in vitro TCGAGGYTAGMCCA
ZKSCAN4ENSG00000187626C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZKSCAN5ENSG00000196652C2H2 ZFKnown motif – High-throughput in vitro DGGAGGTGA
ZKSCAN7ENSG00000196345C2H2 ZFKnown motif – High-throughput in vitro VYAHACTKTNRAGYGV
ZKSCAN8ENSG00000198315C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZMAT1ENSG00000166432C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZMAT4ENSG00000165061C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF10ENSG00000256223C2H2 ZFKnown motif – High-throughput in vitro TGAGGT
ZNF100ENSG00000197020C2H2 ZFKnown motif – High-throughput in vitro VBRNGGCGGCGGCNB
ZNF101ENSG00000181896C2H2 ZFKnown motif – High-throughput in vitro VDGYKGCCCCHGTRTCH
ZNF107ENSG00000196247C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF112ENSG00000062370C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF114ENSG00000178150C2H2 ZFKnown motif – In vivo/Misc source VSSSBSBVVSSBSSSSYHTWTATABVSB
ZNF117ENSG00000152926C2H2 ZFInferred motif from similar protein – In vivo/Misc source GKGCWGCAGM
ZNF12ENSG00000164631C2H2 ZFKnown motif – High-throughput in vitro VYGCKRTAACAARYAKSMCC
ZNF121ENSG00000197961C2H2 ZFKnown motif – High-throughput in vitro VCDGGVCMRVDBWGYVNGRYCCH
ZNF124ENSG00000196418C2H2 ZFKnown motif – High-throughput in vitro AAGAAGGCTTTAATYRGG
ZNF131ENSG00000172262C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF132ENSG00000131849C2H2 ZFKnown motif – High-throughput in vitro VRGGARRGNRGGARG
ZNF133ENSG00000125846C2H2 ZFKnown motif – High-throughput in vitro DGRNMCAAMWNANGTAHAAKTGGHDNH
ZNF134ENSG00000213762C2H2 ZFKnown motif – High-throughput in vitro VYTMAKCAGKKGMNG
ZNF135ENSG00000176293C2H2 ZFKnown motif – High-throughput in vitro HHYTGAGGTYGAGCY
ZNF136ENSG00000196646C2H2 ZFKnown motif – High-throughput in vitro TTCTTGGTTGRCAGKTTT
ZNF138ENSG00000197008C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF14ENSG00000105708C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF140ENSG00000196387C2H2 ZFKnown motif – High-throughput in vitro GAGCGGAATTGYH
ZNF141ENSG00000131127C2H2 ZFKnown motif – High-throughput in vitro RVKGRGRGYGKCCCCC
ZNF142ENSG00000115568C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF143ENSG00000166478C2H2 ZFKnown motif – High-throughput in vitro YWCCCAYAATGCAYYG
ZNF146ENSG00000167635C2H2 ZFKnown motif – High-throughput in vitro GGARTAYTABDCAGC
ZNF148ENSG00000163848C2H2 ZFKnown motif – In vivo/Misc source DGKGGGRGGD
ZNF154ENSG00000179909C2H2 ZFKnown motif – High-throughput in vitro TGTCTAGTARRTCYD
ZNF155ENSG00000204920C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF157ENSG00000147117C2H2 ZFKnown motif – High-throughput in vitro KNNDNGYRYAYTGHWDNCCYYVCCADGHCH
ZNF16ENSG00000170631C2H2 ZFKnown motif – High-throughput in vitro GAGCCAYDGMRGGYKBTD
ZNF160ENSG00000170949C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF165ENSG00000197279C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF169ENSG00000175787C2H2 ZFKnown motif – High-throughput in vitro CTCCCT
ZNF17ENSG00000186272C2H2 ZFKnown motif – High-throughput in vitro VNBNNNNNSTKYMTGYTCHKGNNNV
ZNF174ENSG00000103343C2H2 ZFKnown motif – High-throughput in vitro GSCRAGTGAYYGNC
ZNF175ENSG00000105497C2H2 ZFKnown motif – In vivo/Misc source CYAYACAHRAYAADGAATACA
ZNF177ENSG00000188629C2H2 ZFKnown motif – High-throughput in vitro BTYGRTCKMRNKKNNVAGTCATD
ZNF18ENSG00000154957C2H2 ZFKnown motif – High-throughput in vitro SNRTTCACACY
ZNF180ENSG00000167384C2H2 ZFKnown motif – High-throughput in vitro VGGGVSNGGNGGSGRSBGSGGCVV
ZNF181ENSG00000197841C2H2 ZFKnown motif – High-throughput in vitro VYYYSWGSTWSTNGGRMKGMKGHB
ZNF182ENSG00000147118C2H2 ZFKnown motif – High-throughput in vitro AAAAMMAAAARMAAA
ZNF184ENSG00000096654C2H2 ZFKnown motif – High-throughput in vitro TGGWGARGA
ZNF189ENSG00000136870C2H2 ZFKnown motif – High-throughput in vitro VDGGAASRGMVDNDS
ZNF19ENSG00000157429C2H2 ZFKnown motif – High-throughput in vitro DRGGVBHHDGACRNNDV
ZNF195ENSG00000005801C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF197ENSG00000186448C2H2 ZFKnown motif – High-throughput in vitro RRRGWCARRRRVVVR
ZNF2ENSG00000275111C2H2 ZFKnown motif – High-throughput in vitro SCVCVGVGCYGCGC
ZNF20ENSG00000132010C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF200ENSG00000010539C2H2 ZFKnown motif – High-throughput in vitro BVNVSCGGAAGY
ZNF202ENSG00000166261C2H2 ZFKnown motif – In vivo/Misc source CSCNBCYYCCDCYBCYBSBBCSBSBSCYB
ZNF205ENSG00000122386C2H2 ZFKnown motif – In vivo/Misc source TGGAAT
ZNF207ENSG00000010244C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF208ENSG00000160321C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF211ENSG00000121417C2H2 ZFKnown motif – High-throughput in vitro HNYATATACCAB
ZNF212ENSG00000170260C2H2 ZFKnown motif – In vivo/Misc source CACACAHVHMCACRC
ZNF213ENSG00000085644C2H2 ZFKnown motif – High-throughput in vitro MGAMMBCRGGCGGMG
ZNF214ENSG00000149050C2H2 ZFKnown motif – High-throughput in vitro VWTMATYAANRTCCTCAAVAABD
ZNF215ENSG00000149054C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF217ENSG00000171940C2H2 ZFKnown motif – In vivo/Misc source GKNRGAAT
ZNF219ENSG00000165804C2H2 ZFKnown motif – In vivo/Misc source DGGGGGGYGGW
ZNF22ENSG00000165512C2H2 ZFKnown motif – High-throughput in vitro AAAAAAAAA
ZNF221ENSG00000159905C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF222ENSG00000159885C2H2 ZFKnown motif – High-throughput in vitro GCTGMSAYB
ZNF223ENSG00000178386C2H2 ZFKnown motif – In vivo/Misc source MCACACASASM
ZNF224ENSG00000267680C2H2 ZFKnown motif – High-throughput in vitro WMCYYNKGDGYHMHRKGRMTY
ZNF225ENSG00000256294C2H2 ZFKnown motif – In vivo/Misc source TTAYCWKYDKNRYTTYTTTYTTTTTYYH
ZNF226ENSG00000167380C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF227ENSG00000131115C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF229ENSG00000278318C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF23ENSG00000167377C2H2 ZFKnown motif – High-throughput in vitro DCRMCCATGGCCGCGHCM
ZNF230ENSG00000159882C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF232ENSG00000167840C2H2 ZFKnown motif – High-throughput in vitro RTGTTAAAYGTRGATTAAS
ZNF233ENSG00000159915C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF234ENSG00000263002C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF235ENSG00000159917C2H2 ZFKnown motif – High-throughput in vitro AARARADRAARRAAAWNRDDWDVDNNAWDR
ZNF236ENSG00000130856C2H2 ZFKnown motif – In vivo/Misc source MGTAATATTVM
ZNF239ENSG00000196793C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF24ENSG00000172466C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF248ENSG00000198105C2H2 ZFKnown motif – High-throughput in vitro RHDDACHATRTYCAKBRA
ZNF25ENSG00000175395C2H2 ZFKnown motif – In vivo/Misc source WGAADWANAVARGTYGCWGCATTTAGAAA
ZNF250ENSG00000196150C2H2 ZFKnown motif – High-throughput in vitro YASGCCYAY
ZNF251ENSG00000198169C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF253ENSG00000256771C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF254ENSG00000213096C2H2 ZFKnown motif – High-throughput in vitro ACTGGCYTAGCCTCCCAGCCTACATCTTTCTCC
ZNF256ENSG00000152454C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF257ENSG00000197134C2H2 ZFKnown motif – High-throughput in vitro GAGGMRA
ZNF26ENSG00000198393C2H2 ZFKnown motif – In vivo/Misc source ATTTTT
ZNF260ENSG00000254004C2H2 ZFKnown motif – High-throughput in vitro GGARDRVDANRVDRV
ZNF263ENSG00000006194C2H2 ZFKnown motif – High-throughput in vitro GGGAGSACB
ZNF264ENSG00000083844C2H2 ZFKnown motif – High-throughput in vitro KKGRGSCCYYHNBRATGGGATTAGTGCCCT
ZNF266ENSG00000174652C2H2 ZFKnown motif – High-throughput in vitro VNHRCTCACAGSYCC
ZNF267ENSG00000185947C2H2 ZFKnown motif – High-throughput in vitro VSYNVVGGCNKGBGVRGVDG
ZNF268ENSG00000090612C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF273ENSG00000198039C2H2 ZFKnown motif – High-throughput in vitro GARAGGAGCTAC
ZNF274ENSG00000171606C2H2 ZFKnown motif – High-throughput in vitro VYGAGRACTCAYRY
ZNF275ENSG00000063587C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF276ENSG00000158805C2H2 ZFKnown motif – High-throughput in vitro WAAGGWSGWVDMKACNHCCTTWA
ZNF277ENSG00000198839C2H2 ZF; BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF28ENSG00000198538C2H2 ZFKnown motif – High-throughput in vitro GBNKSHGGGGTGCCM
ZNF280AENSG00000169548C2H2 ZFKnown motif – In vivo/Misc source TCTCWCCWGTRTGRRTTCTYTSAT
ZNF280BENSG00000275004C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF280CENSG00000056277C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF280DENSG00000137871C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF281ENSG00000162702C2H2 ZFKnown motif – High-throughput in vitro KGGGGGAGGGGS
ZNF282ENSG00000170265C2H2 ZFKnown motif – High-throughput in vitro HTCCCMYNACMCK
ZNF283ENSG00000167637C2H2 ZFKnown motif – High-throughput in vitro BNGGCTGRTSBKGSYBGGSYB
ZNF284ENSG00000186026C2H2 ZFKnown motif – High-throughput in vitro GCTGGAGTGCAG
ZNF285ENSG00000267508C2H2 ZFKnown motif – In vivo/Misc source TNTTYTYBYTYDYTYTNHTTT
ZNF286AENSG00000187607C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF286BENSG00000249459C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF287ENSG00000141040C2H2 ZFKnown motif – High-throughput in vitro AAAARAAAARRWARMARAVMWRRARRAVADR
ZNF292ENSG00000188994C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF296ENSG00000170684C2H2 ZFKnown motif – High-throughput in vitro VVTGWCCASYV
ZNF3ENSG00000166526C2H2 ZFKnown motif – High-throughput in vitro TGAHTGAMTRANWGA
ZNF30ENSG00000168661C2H2 ZFKnown motif – High-throughput in vitro CGGACGGGGCGGCTG
ZNF300ENSG00000145908C2H2 ZFKnown motif – In vivo/Misc source KKDGWRDDDGNRKBNDDGDDKKNRNBKRKR
ZNF302ENSG00000089335C2H2 ZFKnown motif – High-throughput in vitro AGTTGAGTGACTGYDSTT
ZNF304ENSG00000131845C2H2 ZFKnown motif – High-throughput in vitro VVGRSYVGRBYGGGGMVGGNV
ZNF311ENSG00000197935C2H2 ZFKnown motif – In vivo/Misc source YYSCDGCBSBNBCYS
ZNF316ENSG00000205903C2H2 ZFKnown motif – In vivo/Misc source KCCSCCGGACCH
ZNF317ENSG00000130803C2H2 ZFKnown motif – High-throughput in vitro RACAGMWGACWD
ZNF318ENSG00000171467C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF319ENSG00000166188C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF32ENSG00000169740C2H2 ZFKnown motif – High-throughput in vitro BGTAAYNYGAYACB
ZNF320ENSG00000182986C2H2 ZFKnown motif – High-throughput in vitro CMYHKKCCCCYKGVHCCCMC
ZNF322ENSG00000181315C2H2 ZFKnown motif – High-throughput in vitro VVGGCHSHGKASCAGDCHS
ZNF324ENSG00000083812C2H2 ZFKnown motif – High-throughput in vitro GRTYRAACCATCCY
ZNF324BENSG00000249471C2H2 ZFKnown motif – In vivo/Misc source HHHDGSMRGSHRAGG
ZNF326ENSG00000162664C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF329ENSG00000181894C2H2 ZFKnown motif – High-throughput in vitro CYKGAKCMVVCYNNDCCTGMA
ZNF331ENSG00000130844C2H2 ZFKnown motif – High-throughput in vitro VVAVSSNNMYWGCWGAGCMCWKYCH
ZNF333ENSG00000160961C2H2 ZFKnown motif – High-throughput in vitro STGGAKSM
ZNF334ENSG00000198185C2H2 ZFKnown motif – In vivo/Misc source YCCGKSMGGGAGGTGRGG
ZNF335ENSG00000198026C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF337ENSG00000130684C2H2 ZFKnown motif – High-throughput in vitro AGTRGTGAYRAATTC
ZNF33AENSG00000189180C2H2 ZFKnown motif – High-throughput in vitro TCAGTGCAC
ZNF33BENSG00000196693C2H2 ZFKnown motif – High-throughput in vitro ATTMAATHCCHTYYNHTDVMW
ZNF34ENSG00000196378C2H2 ZFKnown motif – In vivo/Misc source DRARGAVAAGYCTGD
ZNF341ENSG00000131061C2H2 ZFKnown motif – In vivo/Misc source VVVRRVRRNDVVNGGARSAGC
ZNF343ENSG00000088876C2H2 ZFKnown motif – High-throughput in vitro KRCCGHGGKGAAGCGB
ZNF345ENSG00000251247C2H2 ZFKnown motif – High-throughput in vitro TTGCAACVYVNRCAACYGKAC
ZNF346ENSG00000113761C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF347ENSG00000197937C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF35ENSG00000169981C2H2 ZFKnown motif – High-throughput in vitro ATATRTAAAGAGYTYYTABAA
ZNF350ENSG00000256683C2H2 ZFKnown motif – High-throughput in vitro DNBDVRKHAWAAAARRRCH
ZNF354AENSG00000169131C2H2 ZFKnown motif – High-throughput in vitro RTAAATGGHYTAAAY
ZNF354BENSG00000178338C2H2 ZFKnown motif – High-throughput in vitro AAKGRRMTAWHY
ZNF354CENSG00000177932C2H2 ZFKnown motif – In vivo/Misc source VTCCAC
ZNF358ENSG00000198816C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF362ENSG00000160094C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF365ENSG00000138311C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF366ENSG00000178175C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF367ENSG00000165244C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF37AENSG00000075407C2H2 ZFKnown motif – High-throughput in vitro GGARRRRRV
ZNF382ENSG00000161298C2H2 ZFKnown motif – High-throughput in vitro GWGVMANYASTACAGRYMHHRBDS
ZNF383ENSG00000188283C2H2 ZFKnown motif – High-throughput in vitro GAGSVRVRASRKGGMAGGRRBCNGGGY
ZNF384ENSG00000126746C2H2 ZFKnown motif – High-throughput in vitro TTTTBNNNNNNNNNNNNVAAAA
ZNF385AENSG00000161642C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF385BENSG00000144331C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF385CENSG00000187595C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF385DENSG00000151789C2H2 ZFKnown motif – High-throughput in vitro HHGTCGCGACRD
ZNF391ENSG00000124613C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF394ENSG00000160908C2H2 ZFKnown motif – In vivo/Misc source VVRGGAGNAGCWGNRVVDNV
ZNF395ENSG00000186918C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF396ENSG00000186496C2H2 ZFKnown motif – High-throughput in vitro VTTTCGKACAB
ZNF397ENSG00000186812C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF398ENSG00000197024C2H2 ZFKnown motif – In vivo/Misc source DGGGARRGARRSAG
ZNF404ENSG00000176222C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF407ENSG00000215421C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF408ENSG00000175213C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF41ENSG00000147124C2H2 ZFKnown motif – High-throughput in vitro RMARGGRARNNNRRSACMATGAGNVAV
ZNF410ENSG00000119725C2H2 ZFKnown motif – High-throughput in vitro MCATCCCATAATANBM
ZNF414ENSG00000133250C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF415ENSG00000170954C2H2 ZFKnown motif – In vivo/Misc source VTRCVCVMTKARBATC
ZNF416ENSG00000083817C2H2 ZFKnown motif – In vivo/Misc source TRGCCCAGTCAAGTTGAC
ZNF417ENSG00000173480C2H2 ZFKnown motif – High-throughput in vitro HNGGCGCCAVNTG
ZNF418ENSG00000196724C2H2 ZFKnown motif – High-throughput in vitro VDGWRGCYAAAAGCA
ZNF419ENSG00000105136C2H2 ZFKnown motif – High-throughput in vitro DGGARAGKMHAGGRCTGBADW
ZNF420ENSG00000197050C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF423ENSG00000102935C2H2 ZFKnown motif – In vivo/Misc source GRCACCCWAGGGTGC
ZNF425ENSG00000204947C2H2 ZFKnown motif – In vivo/Misc source GGBACA
ZNF426ENSG00000130818C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF428ENSG00000131116C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF429ENSG00000197013C2H2 ZFKnown motif – High-throughput in vitro DGGMRKAGSHVNMAATGGGYH
ZNF43ENSG00000198521C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF430ENSG00000118620C2H2 ZFKnown motif – High-throughput in vitro MCADGGHRGMNDGCHR
ZNF431ENSG00000196705C2H2 ZFKnown motif – In vivo/Misc source VRGGCTRGMWGNYNV
ZNF432ENSG00000256087C2H2 ZFKnown motif – In vivo/Misc source GTYRAAAACAAT
ZNF433ENSG00000197647C2H2 ZFKnown motif – High-throughput in vitro RDGACYRHWGTRRTAAYY
ZNF436ENSG00000125945C2H2 ZFKnown motif – High-throughput in vitro TCCTCCAGGAAGCCY
ZNF438ENSG00000183621C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF439ENSG00000171291C2H2 ZFKnown motif – In vivo/Misc source CARTCACCYYCHGGV
ZNF44ENSG00000197857C2H2 ZFKnown motif – High-throughput in vitro VBGNTVYKGCHGYDVNG
ZNF440ENSG00000171295C2H2 ZFKnown motif – High-throughput in vitro RRTKGTTCTGCW
ZNF441ENSG00000197044C2H2 ZFKnown motif – High-throughput in vitro SRGRCGGAGYB
ZNF442ENSG00000198342C2H2 ZFKnown motif – In vivo/Misc source SHWDWTWTTTNHHTTTTT
ZNF443ENSG00000180855C2H2 ZFKnown motif – High-throughput in vitro GYCTBCYMAGWHGCKGGBRTT
ZNF444ENSG00000167685C2H2 ZFKnown motif – High-throughput in vitro DGGGGGAGGGGGAYG
ZNF445ENSG00000185219C2H2 ZFKnown motif – In vivo/Misc source AAMTYCYYGASNRNMMAGGRKTMYYYCHC
ZNF446ENSG00000083838C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF449ENSG00000173275C2H2 ZFKnown motif – High-throughput in vitro RCGCCCAACC
ZNF45ENSG00000124459C2H2 ZFKnown motif – High-throughput in vitro AGGAANAYA
ZNF451ENSG00000112200C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF454ENSG00000178187C2H2 ZFKnown motif – High-throughput in vitro WRGCGCCWGGCGCYW
ZNF460ENSG00000197714C2H2 ZFKnown motif – High-throughput in vitro CAACGCCCCCCG
ZNF461ENSG00000197808C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF462ENSG00000148143C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF467ENSG00000181444C2H2 ZFKnown motif – High-throughput in vitro GGDGGGGGAGGG
ZNF468ENSG00000204604C2H2 ZFKnown motif – High-throughput in vitro DGGGAGGGGGYGSNS
ZNF469ENSG00000225614C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF470ENSG00000197016C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF471ENSG00000196263C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF473ENSG00000142528C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF474ENSG00000164185C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF479ENSG00000185177C2H2 ZFKnown motif – High-throughput in vitro GADGACYYKGRGGRY
ZNF48ENSG00000180035C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF480ENSG00000198464C2H2 ZFKnown motif – High-throughput in vitro DRDGAAKGDGDD
ZNF483ENSG00000173258C2H2 ZFKnown motif – High-throughput in vitro DSAGRGAGCTGCA
ZNF484ENSG00000127081C2H2 ZFKnown motif – High-throughput in vitro VRDGGAVWGVRGMASWDGVNV
ZNF485ENSG00000198298C2H2 ZFKnown motif – High-throughput in vitro AYTTSSWWTKKSRMYRTRKGS
ZNF486ENSG00000256229C2H2 ZFKnown motif – In vivo/Misc source VVBBBNSNGCSGAMDCCCGGV
ZNF487ENSG00000243660C2H2 ZFKnown motif – In vivo/Misc source VVBBBNSNGCSGAMDCCCGGV
ZNF488ENSG00000265763C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF490ENSG00000188033C2H2 ZFKnown motif – In vivo/Misc source HDGNMRGCAGCANAY
ZNF491ENSG00000177599C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF492ENSG00000229676C2H2 ZFKnown motif – High-throughput in vitro MNAARARMAMBAAAARGG
ZNF493ENSG00000196268C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF496ENSG00000162714C2H2 ZFKnown motif – In vivo/Misc source BCNSBCYCYBHMYYHSHBYCY
ZNF497ENSG00000174586C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF500ENSG00000103199C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF501ENSG00000186446C2H2 ZFKnown motif – High-throughput in vitro GCGACGCGAMCV
ZNF502ENSG00000196653C2H2 ZFKnown motif – High-throughput in vitro GGACYDBTGCAGTAGYHH
ZNF503ENSG00000165655C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF506ENSG00000081665C2H2 ZFKnown motif – High-throughput in vitro YTGGGGGCTCVBMC
ZNF507ENSG00000168813C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF510ENSG00000081386C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF511ENSG00000198546C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF512ENSG00000243943C2H2 ZF; BED ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF512BENSG00000196700C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF513ENSG00000163795C2H2 ZFKnown motif – High-throughput in vitro GATGRTGATGATGRT
ZNF514ENSG00000144026C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF516ENSG00000101493C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF517ENSG00000197363C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF518AENSG00000177853C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF518BENSG00000178163C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF519ENSG00000175322C2H2 ZFKnown motif – High-throughput in vitro GGGCGGCKGCRGCBGCGS
ZNF521ENSG00000198795C2H2 ZFKnown motif – In vivo/Misc source TGGGGGMCCCCW
ZNF524ENSG00000171443C2H2 ZF; AT hookKnown motif – High-throughput in vitro YTCGVACCC
ZNF525ENSG00000203326C2H2 ZFKnown motif – High-throughput in vitro RTTMCTWATDMAGNT
ZNF526ENSG00000167625C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF527ENSG00000189164C2H2 ZFKnown motif – In vivo/Misc source DGRKNGBMDGHRACAGMRR
ZNF528ENSG00000167555C2H2 ZFKnown motif – High-throughput in vitro GGAAGYCATTTC
ZNF529ENSG00000186020C2H2 ZFKnown motif – In vivo/Misc source CYCYBYCTBCYHDSM
ZNF530ENSG00000183647C2H2 ZFKnown motif – High-throughput in vitro GMADGGMNAGGGSCNGVV
ZNF532ENSG00000074657C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF534ENSG00000198633C2H2 ZFKnown motif – High-throughput in vitro GVGGGGMRAGARBNBVV
ZNF536ENSG00000198597C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF540ENSG00000171817C2H2 ZFKnown motif – In vivo/Misc source RGRGGVAGGVA
ZNF541ENSG00000118156C2H2 ZF; Myb/SANTKnown motif – In vivo/Misc source CCCATGCGCGGG
ZNF543ENSG00000178229C2H2 ZFKnown motif – High-throughput in vitro SSVCWGGVCMGS
ZNF544ENSG00000198131C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF546ENSG00000187187C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF547ENSG00000152433C2H2 ZFKnown motif – High-throughput in vitro GCWAAYKCWGCARGC
ZNF548ENSG00000188785C2H2 ZFKnown motif – High-throughput in vitro GBBGCKGCDGSVSSVSVG
ZNF549ENSG00000121406C2H2 ZFKnown motif – High-throughput in vitro ATGAAYYGGGCAGCM
ZNF550ENSG00000251369C2H2 ZFKnown motif – High-throughput in vitro DNVRRDGCWRRGGYAGRG
ZNF551ENSG00000204519C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF552ENSG00000178935C2H2 ZFKnown motif – High-throughput in vitro CCACGAGGGGH
ZNF554ENSG00000172006C2H2 ZFKnown motif – High-throughput in vitro CHGRGYCANNYRGDKDRCH
ZNF555ENSG00000186300C2H2 ZFKnown motif – In vivo/Misc source AAAAAGCCGCGGCGG
ZNF556ENSG00000172000C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF557ENSG00000130544C2H2 ZFKnown motif – In vivo/Misc source MAGARTGYT
ZNF558ENSG00000167785C2H2 ZFKnown motif – High-throughput in vitro HKGRAYHTGTRGRTKBATRYCTTYCAK
ZNF559ENSG00000188321C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF560ENSG00000198028C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF561ENSG00000171469C2H2 ZFKnown motif – In vivo/Misc source DSNGCMGAAARGSBBYBBBCC
ZNF562ENSG00000171466C2H2 ZFKnown motif – In vivo/Misc source DDYYCAGCAAGGCAMWWT
ZNF563ENSG00000188868C2H2 ZFKnown motif – High-throughput in vitro BTCMBNNSHRGCMRCHGY
ZNF564ENSG00000249709C2H2 ZFKnown motif – High-throughput in vitro GGGAAGTCCAAG
ZNF565ENSG00000196357C2H2 ZFKnown motif – High-throughput in vitro ATGYTGTGAGGAAGCYCA
ZNF566ENSG00000186017C2H2 ZFKnown motif – High-throughput in vitro VNDGCKGVAARGGARSC
ZNF567ENSG00000189042C2H2 ZFKnown motif – High-throughput in vitro VHAVAARHAGAMMHHNARRTG
ZNF568ENSG00000198453C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF569ENSG00000196437C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF57ENSG00000171970C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF570ENSG00000171827C2H2 ZFKnown motif – High-throughput in vitro ARAHAWMWHNMAAGAAAA
ZNF571ENSG00000180479C2H2 ZFKnown motif – High-throughput in vitro SSGMGGCBGMGGCRG
ZNF572ENSG00000180938C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF573ENSG00000189144C2H2 ZFKnown motif – High-throughput in vitro MAGHMMDGGCMCAMNMADB
ZNF574ENSG00000105732C2H2 ZFKnown motif – High-throughput in vitro CTAGAGMGKCSS
ZNF575ENSG00000176472C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF576ENSG00000124444C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF577ENSG00000161551C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF578ENSG00000258405C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF579ENSG00000218891C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF580ENSG00000213015C2H2 ZFKnown motif – High-throughput in vitro VCTACCNYHNNVCTACCNH
ZNF581ENSG00000171425C2H2 ZFKnown motif – In vivo/Misc source CTTCTAVAAGV
ZNF582ENSG00000018869C2H2 ZFKnown motif – High-throughput in vitro KYMSYTGCMGCCNARNGCAYBCYH
ZNF583ENSG00000198440C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF584ENSG00000171574C2H2 ZFKnown motif – High-throughput in vitro DNTTTMARAAHTGYTWTGGDH
ZNF585AENSG00000196967C2H2 ZFKnown motif – High-throughput in vitro TCYGTWYTY
ZNF585BENSG00000245680C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF586ENSG00000083828C2H2 ZFKnown motif – High-throughput in vitro CAGGCCYRGAGG
ZNF587ENSG00000198466C2H2 ZFKnown motif – High-throughput in vitro MCMRYGTTGGGCGCHANNHD
ZNF587BENSG00000269343C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF589ENSG00000164048C2H2 ZFKnown motif – In vivo/Misc source VSRBDRWWVCCBYKK
ZNF592ENSG00000166716C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF594ENSG00000180626C2H2 ZFKnown motif – High-throughput in vitro RDDSDGAGAGCNSS
ZNF595ENSG00000272602C2H2 ZFKnown motif – High-throughput in vitro GGGAGGGMWKC
ZNF596ENSG00000172748C2H2 ZFKnown motif – High-throughput in vitro VGVRRGAGVSMGAGM
ZNF597ENSG00000167981C2H2 ZFKnown motif – High-throughput in vitro CAARATGGCGKM
ZNF598ENSG00000167962C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF599ENSG00000153896C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF600ENSG00000189190C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF605ENSG00000196458C2H2 ZFKnown motif – High-throughput in vitro DGGKNNDDAGRVVCCMNRVD
ZNF606ENSG00000166704C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF607ENSG00000198182C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF608ENSG00000168916C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF609ENSG00000180357C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF610ENSG00000167554C2H2 ZFKnown motif – High-throughput in vitro GGAGCGGC
ZNF611ENSG00000213020C2H2 ZFKnown motif – High-throughput in vitro GGAGMGCCBVNGVVBVSCBSB
ZNF613ENSG00000176024C2H2 ZFKnown motif – High-throughput in vitro WAAAAAAAB
ZNF614ENSG00000142556C2H2 ZFKnown motif – In vivo/Misc source BDCTTKAKCTMATKD
ZNF615ENSG00000197619C2H2 ZFKnown motif – High-throughput in vitro AAABDVCTGYBSCCC
ZNF616ENSG00000204611C2H2 ZFKnown motif – High-throughput in vitro RHRGGTGAGCRY
ZNF618ENSG00000157657C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF619ENSG00000177873C2H2 ZFKnown motif – In vivo/Misc source BYNNBCCCCNNCCYCAGGAAT
ZNF620ENSG00000177842C2H2 ZFKnown motif – In vivo/Misc source WKTSYAKTY
ZNF621ENSG00000172888C2H2 ZFKnown motif – In vivo/Misc source RRRVKCYCAGGGMAG
ZNF623ENSG00000183309C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF624ENSG00000197566C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF625ENSG00000257591C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF626ENSG00000188171C2H2 ZFKnown motif – High-throughput in vitro HDVRTNNKGYTVHKVTGBYCCYTSYH
ZNF627ENSG00000198551C2H2 ZFKnown motif – High-throughput in vitro TTTAAGCCCACTGTTGAG
ZNF628ENSG00000197483C2H2 ZFKnown motif – In vivo/Misc source GCAACCAACCTTG
ZNF629ENSG00000102870C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF630ENSG00000221994C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF639ENSG00000121864C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF641ENSG00000167528C2H2 ZFKnown motif – High-throughput in vitro TGGGGGGGT
ZNF644ENSG00000122482C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF645ENSG00000175809C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF646ENSG00000167395C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF648ENSG00000179930C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF649ENSG00000198093C2H2 ZFKnown motif – High-throughput in vitro ATATAA
ZNF652ENSG00000198740C2H2 ZFInferred motif from similar protein – High-throughput in vitro
ZNF653ENSG00000161914C2H2 ZF; AT hookKnown motif – In vivo/Misc source WTTHNYDHCYKCCGACWNHWAWD
ZNF654ENSG00000175105C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF655ENSG00000197343C2H2 ZFKnown motif – High-throughput in vitro RVTAH
ZNF658ENSG00000274349C2H2 ZFKnown motif – In vivo/Misc source GGGGTRGGACGAGGTGGG
ZNF66ENSG00000160229C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF660ENSG00000144792C2H2 ZFKnown motif – High-throughput in vitro DYAGGDTGGRBHATCADB
ZNF662ENSG00000182983C2H2 ZFKnown motif – High-throughput in vitro DRNAGSMVVGKGMYAGMB
ZNF664ENSG00000179195C2H2 ZFInferred motif from similar protein – In vivo/Misc source GTTBAAWMCGC
ZNF665ENSG00000197497C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF667ENSG00000198046C2H2 ZFKnown motif – High-throughput in vitro GCYTTAARAGCTCANCH
ZNF668ENSG00000167394C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF669ENSG00000188295C2H2 ZFKnown motif – High-throughput in vitro VNHHRSANYGGTCRTCRNCCH
ZNF670ENSG00000277462C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF671ENSG00000083814C2H2 ZFKnown motif – High-throughput in vitro GAKTGGADBRV
ZNF672ENSG00000171161C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF674ENSG00000251192C2H2 ZFKnown motif – High-throughput in vitro GGRBCVCCRVV
ZNF675ENSG00000197372C2H2 ZFKnown motif – High-throughput in vitro RKGVNHNRGRGGMYAAAAYGD
ZNF676ENSG00000196109C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF677ENSG00000197928C2H2 ZFKnown motif – High-throughput in vitro GRAMMCHRAHAAGAWCAGHH
ZNF678ENSG00000181450C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF679ENSG00000197123C2H2 ZFInferred motif from similar protein – In vivo/Misc source DGGCAGCAGM
ZNF680ENSG00000173041C2H2 ZFKnown motif – High-throughput in vitro HNNNNDGNCMAAGAAGAHTNW
ZNF681ENSG00000196172C2H2 ZFKnown motif – High-throughput in vitro VAAGGABGVNGR
ZNF682ENSG00000197124C2H2 ZFKnown motif – High-throughput in vitro DDHYMAGCCC
ZNF683ENSG00000176083C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF684ENSG00000117010C2H2 ZFKnown motif – High-throughput in vitro BACAGTCCACCCCTTDV
ZNF687ENSG00000143373C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF688ENSG00000229809C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF689ENSG00000156853C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF69ENSG00000198429C2H2 ZFKnown motif – In vivo/Misc source GGRGSHGGGGBDGGV
ZNF691ENSG00000164011C2H2 ZFInferred motif from similar protein – High-throughput in vitro RKGAGYAC
ZNF692ENSG00000171163C2H2 ZFKnown motif – In vivo/Misc source SBGGGVCCCACH
ZNF695ENSG00000197472C2H2 ZFKnown motif – In vivo/Misc source ACCAMMHMC
ZNF696ENSG00000185730C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF697ENSG00000143067C2H2 ZFInferred motif from similar protein – In vivo/Misc source KKKGCGAGGGM
ZNF699ENSG00000196110C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF7ENSG00000147789C2H2 ZFKnown motif – High-throughput in vitro VWRRMADYWNYAARWGBWGRC
ZNF70ENSG00000187792C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF700ENSG00000196757C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF701ENSG00000167562C2H2 ZFKnown motif – High-throughput in vitro GAGMASYHDRGG
ZNF703ENSG00000183779C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF704ENSG00000164684C2H2 ZFKnown motif – High-throughput in vitro HRCCGGCCGGYD
ZNF705AENSG00000196946C2H2 ZFInferred motif from similar protein – In vivo/Misc source CCAAAARAAYY
ZNF705BENSG00000215356C2H2 ZFInferred motif from similar protein – In vivo/Misc source CCAAAARAAYY
ZNF705DENSG00000215343C2H2 ZFInferred motif from similar protein – In vivo/Misc source CCAAAARAAYY
ZNF705EENSG00000214534C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF705GENSG00000215372C2H2 ZFKnown motif – In vivo/Misc source RAKAAACCTCY
ZNF706ENSG00000120963C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF707ENSG00000181135C2H2 ZFKnown motif – High-throughput in vitro DACMAGGAGTGGGGTK
ZNF708ENSG00000182141C2H2 ZFKnown motif – High-throughput in vitro RDDAGGYACAGCH
ZNF709ENSG00000242852C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF71ENSG00000197951C2H2 ZFKnown motif – High-throughput in vitro BRGNRGSMRRRGVRARRARRGMAA
ZNF710ENSG00000140548C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF711ENSG00000147180C2H2 ZFKnown motif – In vivo/Misc source MGGCCTVS
ZNF713ENSG00000178665C2H2 ZFKnown motif – High-throughput in vitro WAGAMRAAWGCCACGAA
ZNF714ENSG00000160352C2H2 ZFKnown motif – High-throughput in vitro DKMRKTSCTGCT
ZNF716ENSG00000182111C2H2 ZFKnown motif – High-throughput in vitro VTATTTCY
ZNF717ENSG00000227124C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF718ENSG00000250312C2H2 ZFKnown motif – In vivo/Misc source GGGRATWGCGM
ZNF721ENSG00000182903C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF724ENSG00000196081C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF726ENSG00000213967C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF727ENSG00000214652C2H2 ZFKnown motif – In vivo/Misc source GGTCCAAWTGM
ZNF728ENSG00000269067C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF729ENSG00000196350C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF730ENSG00000183850C2H2 ZFKnown motif – High-throughput in vitro GGGMRGSBRNGG
ZNF732ENSG00000186777C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF735ENSG00000223614C2H2 ZFKnown motif – In vivo/Misc source DGGCAGCAGM
ZNF736ENSG00000234444C2H2 ZFKnown motif – High-throughput in vitro YCYRGGGYTTTT
ZNF737ENSG00000237440C2H2 ZFKnown motif – In vivo/Misc source RKRVDGRDGVWGGDG
ZNF74ENSG00000185252C2H2 ZFKnown motif – In vivo/Misc source RAAGATGTTCHYYDCVKYRTTRTTTAHVW
ZNF740ENSG00000139651C2H2 ZFKnown motif – High-throughput in vitro YNCCCCCCCCAC
ZNF746ENSG00000181220C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF747ENSG00000169955C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF749ENSG00000186230C2H2 ZFKnown motif – High-throughput in vitro GYTGGGGYT
ZNF750ENSG00000141579C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF75AENSG00000162086C2H2 ZFKnown motif – High-throughput in vitro TGTGGGAAAASM
ZNF75DENSG00000186376C2H2 ZFKnown motif – High-throughput in vitro GTGGGAAAKCCTTYH
ZNF76ENSG00000065029C2H2 ZFKnown motif – High-throughput in vitro HWCCCABAATGCAHYRCR
ZNF761ENSG00000160336C2H2 ZFKnown motif – In vivo/Misc source KGDWAATCAKA
ZNF763ENSG00000197054C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF764ENSG00000169951C2H2 ZFKnown motif – In vivo/Misc source TGCARCCYAGCTCTAYDAGMC
ZNF765ENSG00000196417C2H2 ZFKnown motif – High-throughput in vitro CTBGGCHVNGCMCWGVS
ZNF766ENSG00000196214C2H2 ZFKnown motif – In vivo/Misc source RAKAAACCYYH
ZNF768ENSG00000169957C2H2 ZFKnown motif – High-throughput in vitro CHCAGAGAGGKYRAG
ZNF77ENSG00000175691C2H2 ZFKnown motif – In vivo/Misc source TYMYCACTYCACYHNNNHMAD
ZNF770ENSG00000198146C2H2 ZFKnown motif – In vivo/Misc source GGAGGCYGVVV
ZNF771ENSG00000179965C2H2 ZFKnown motif – High-throughput in vitro RCGCTAACCAYTD
ZNF772ENSG00000197128C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF773ENSG00000152439C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF774ENSG00000196391C2H2 ZFKnown motif – High-throughput in vitro DGRRRVRGAGVHDGRRD
ZNF775ENSG00000196456C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF776ENSG00000152443C2H2 ZFKnown motif – High-throughput in vitro GAAGCAHRRYGCYGGCATCTG
ZNF777ENSG00000196453C2H2 ZFKnown motif – In vivo/Misc source GHCCSYCCCGTCSARCAAW
ZNF778ENSG00000170100C2H2 ZFKnown motif – High-throughput in vitro CAGACRMCRRCH
ZNF780AENSG00000197782C2H2 ZFKnown motif – High-throughput in vitro VNNNNDNNHDGGCAGGYNBNYDDV
ZNF780BENSG00000128000C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF781ENSG00000196381C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF782ENSG00000196597C2H2 ZFKnown motif – In vivo/Misc source HARRHCCWACAHVDRGRSHNYCTCAVRVVY
ZNF783ENSG00000204946C2H2 ZFKnown motif – In vivo/Misc source SBTSCWSCDSCDSYDSCWGCT
ZNF784ENSG00000179922C2H2 ZFKnown motif – High-throughput in vitro ACYTWCCK
ZNF785ENSG00000197162C2H2 ZFKnown motif – In vivo/Misc source ACWBRBRCAYACASWYVMMCVMACACASA
ZNF786ENSG00000197362C2H2 ZFKnown motif – In vivo/Misc source CRGRGNCCCRRRGRC
ZNF787ENSG00000142409C2H2 ZFKnown motif – High-throughput in vitro BGAGGCANNNNNNNTGCATY
ZNF788ENSG00000214189C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF789ENSG00000198556C2H2 ZFKnown motif – High-throughput in vitro CYYSTGACACCH
ZNF79ENSG00000196152C2H2 ZFKnown motif – High-throughput in vitro AAAVRAAWDAATNTCTAA
ZNF790ENSG00000197863C2H2 ZFKnown motif – High-throughput in vitro GTGCAGCA
ZNF791ENSG00000173875C2H2 ZFKnown motif – In vivo/Misc source CKCTGACCCCDCCTCCYBTCTAAA
ZNF792ENSG00000180884C2H2 ZFKnown motif – In vivo/Misc source DRCTGDTKWNHDBAGATAGKR
ZNF793ENSG00000188227C2H2 ZFKnown motif – High-throughput in vitro GARCCCCAAGVV
ZNF799ENSG00000196466C2H2 ZFKnown motif – High-throughput in vitro AYMCYBGYTGTCTCAGTGWTTKGS
ZNF8ENSG00000278129C2H2 ZFKnown motif – High-throughput in vitro DHNDDGRCRTACCRBV
ZNF80ENSG00000174255C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF800ENSG00000048405C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF804AENSG00000170396C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF804BENSG00000182348C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF805ENSG00000204524C2H2 ZFKnown motif – High-throughput in vitro MYKSCATTCCWTKSCWTKYSR
ZNF808ENSG00000198482C2H2 ZFKnown motif – High-throughput in vitro GGNWGGWCTVYAAAVNVSHYKBTHNDKND
ZNF81ENSG00000197779C2H2 ZFKnown motif – High-throughput in vitro TGGTVNHACYABYNNRRA
ZNF813ENSG00000198346C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF814ENSG00000204514C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF816ENSG00000180257C2H2 ZFKnown motif – High-throughput in vitro VVNNRDGGGGACMKGHND
ZNF821ENSG00000102984C2H2 ZFKnown motif – High-throughput in vitro HRGACAGACVGACR
ZNF823ENSG00000197933C2H2 ZFKnown motif – High-throughput in vitro HHYTTCTCYNYYBCY
ZNF827ENSG00000151612C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF829ENSG00000185869C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF83ENSG00000167766C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF830ENSG00000198783C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF831ENSG00000124203C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF835ENSG00000127903C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF836ENSG00000196267C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF837ENSG00000152475C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF84ENSG00000198040C2H2 ZFKnown motif – High-throughput in vitro RVRRVNNVNRDGAACAGGMAR
ZNF841ENSG00000197608C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF843ENSG00000176723C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF844ENSG00000223547C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF845ENSG00000213799C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF846ENSG00000196605C2H2 ZFKnown motif – In vivo/Misc source GVGSMVGGGMSVSVG
ZNF85ENSG00000105750C2H2 ZFKnown motif – High-throughput in vitro BRGATTMCWKCA
ZNF850ENSG00000267041C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF852ENSG00000178917C2H2 ZFInferred motif from similar protein – High-throughput in vitro VYAHACTKTNRAGYGV
ZNF853ENSG00000236609C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF860ENSG00000197385C2H2 ZFKnown motif – High-throughput in vitro VRCAGGGAGCVRVVS
ZNF865ENSG00000261221C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF878ENSG00000257446C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF879ENSG00000234284C2H2 ZFKnown motif – High-throughput in vitro AHARHAMWAHWRAAMMWANWWRVH
ZNF880ENSG00000221923C2H2 ZFKnown motif – High-throughput in vitro DDNDDVDNGGGRRDGGGARAGDGMAR
ZNF883ENSG00000228623C2H2 ZFKnown motif – In vivo/Misc source GAGGCAGCCACH
ZNF888ENSG00000213793C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF891ENSG00000214029C2H2 ZFKnown motif – High-throughput in vitro BNNNNSNGRCWKCYAGCC
ZNF90ENSG00000213988C2H2 ZFKnown motif – High-throughput in vitro TGGGTGDRTMAKCAG
ZNF91ENSG00000167232C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF92ENSG00000146757C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZNF93ENSG00000184635C2H2 ZFKnown motif – High-throughput in vitro BNNNBNHNGCWGCHRBSNYWGCTRCYDYC
ZNF98ENSG00000197360C2H2 ZFKnown motif – High-throughput in vitro VNADRKMCAANAAAAAGGHM
ZNF99ENSG00000213973C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN1ENSG00000152467C2H2 ZFKnown motif – High-throughput in vitro HRCACACVCTGHMAVH
ZSCAN10ENSG00000130182C2H2 ZFInferred motif from similar protein – High-throughput in vitro GDRAGTGC
ZSCAN12ENSG00000158691C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN16ENSG00000196812C2H2 ZFKnown motif – High-throughput in vitro GAGGCTCTGTTAACANY
ZSCAN18ENSG00000121413C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN2ENSG00000176371C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN20ENSG00000121903C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN21ENSG00000166529C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN22ENSG00000182318C2H2 ZFKnown motif – High-throughput in vitro GNCHGABGGMGGAGGCNV
ZSCAN23ENSG00000187987C2H2 ZFKnown motif – High-throughput in vitro BTGTAATTAGCACATGR
ZSCAN25ENSG00000197037C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN26ENSG00000197062C2H2 ZFKnown motif – In vivo/Misc source TGGGGGGCATM
ZSCAN29ENSG00000140265C2H2 ZFKnown motif – High-throughput in vitro MCGYRTARMCGKCTAYRC
ZSCAN30ENSG00000186814C2H2 ZFKnown motif – High-throughput in vitro BCCWGSRGCCHBSVS
ZSCAN31ENSG00000235109C2H2 ZFKnown motif – High-throughput in vitro GHHGCAGGGCARTTATGC
ZSCAN32ENSG00000140987C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN4ENSG00000180532C2H2 ZFKnown motif – High-throughput in vitro HGCACACVCTGNMA
ZSCAN5AENSG00000131848C2H2 ZFKnown motif – High-throughput in vitro HKTCCCYVCVCAAADM
ZSCAN5BENSG00000197213C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZSCAN5CENSG00000204532C2H2 ZFKnown motif – High-throughput in vitro GTGAGTNHAYRRRNV
ZSCAN9ENSG00000137185C2H2 ZFKnown motif – High-throughput in vitro DRKGATAAGATAAGAABCM
ZUFSPENSG00000153975C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZXDAENSG00000198205C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZXDBENSG00000198455C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZXDCENSG00000070476C2H2 ZFLikely sequence specific TF according to literature or domain structure – No motif
ZZZ3ENSG00000036549Myb/SANTKnown motif – High-throughput in vitro SAATCCAW

References

  1. Lambert, Samuel; Arttu, Jolma; Campitelli, Laura; Das, Pratyush; Yin, Yimeng; Albu, Mihai; Chen, Xiaoting; Taipale, Jussi; Hughes, Timothy; Weirauch, Matthew (February 2018). "The Human Transcription Factors". Cell. 172 (4): 650–665. doi:10.1016/j.cell.2018.01.029. PMID 29425488.
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.